(data stored in ACNUC7421 zone)

EMBL: CP001791.PE505

CP001791.PE505       Location/Qualifiers
FT   CDS             552739..553932
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0521"
FT                   /product="ornithine aminotransferase"
FT                   /note="KEGG: dat:HRM2_23580 RocD1; TIGRFAM: ornithine
FT                   aminotransferase; PFAM: aminotransferase class-III"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0521"
FT                   /db_xref="EnsemblGenomes-Tr:ADH98057"
FT                   /db_xref="GOA:D6XXY4"
FT                   /db_xref="InterPro:IPR005814"
FT                   /db_xref="InterPro:IPR010164"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR034757"
FT                   /db_xref="UniProtKB/TrEMBL:D6XXY4"
FT                   /inference="protein motif:TFAM:TIGR01885"
FT                   /protein_id="ADH98057.1"
FT                   /translation="MTKTMDIIEVTEKYGARNYHPLPIVIAKAEGVWVEDPEGNRYIDM
FT                   LSAYSAVNQGHRHPKIIQALKDQADRITLTSRAFHNDQLGAFYEKVSKMTNKDMVLPMN
FT                   TGAEAVETAVKAVRRWAYRVKGVPENQAEIIVCEENFHGRTMTAVSLSSNEAYKKDFGP
FT                   MLPGIKVIPYGDLNALKEAITPNTAAFLFEPIQGEAGINMPPEGFLKEAYELCRENRVL
FT                   YVADEIQCGLARSGKLFACDWEEVEPDMYILGKALGGGVMPISCVAANEEILGVFEPGS
FT                   HGSTFGGNPLSCAVSVAALDVIESEQLAERSLRLGTYFKEQLETLDNPKIREVRGRGLF
FT                   IGVEMTEAARPYCEALKEKGLLCKETHENVIRFAPPLVISEEDLDWAIGQIKDVLKG"
     MTKTMDIIEV TEKYGARNYH PLPIVIAKAE GVWVEDPEGN RYIDMLSAYS AVNQGHRHPK        60
     IIQALKDQAD RITLTSRAFH NDQLGAFYEK VSKMTNKDMV LPMNTGAEAV ETAVKAVRRW       120
     AYRVKGVPEN QAEIIVCEEN FHGRTMTAVS LSSNEAYKKD FGPMLPGIKV IPYGDLNALK       180
     EAITPNTAAF LFEPIQGEAG INMPPEGFLK EAYELCRENR VLYVADEIQC GLARSGKLFA       240
     CDWEEVEPDM YILGKALGGG VMPISCVAAN EEILGVFEPG SHGSTFGGNP LSCAVSVAAL       300
     DVIESEQLAE RSLRLGTYFK EQLETLDNPK IREVRGRGLF IGVEMTEAAR PYCEALKEKG       360
     LLCKETHENV IRFAPPLVIS EEDLDWAIGQ IKDVLKG                                397
//

If you have problems or comments...

PBIL Back to PBIL home page