(data stored in ACNUC7421 zone)

EMBL: CP001791.PE506

CP001791.PE506       Location/Qualifiers
FT   CDS             554004..554945
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0522"
FT                   /product="Proline dehydrogenase"
FT                   /note="PFAM: Proline dehydrogenase; KEGG: mxa:MXAN_7405
FT                   proline dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0522"
FT                   /db_xref="EnsemblGenomes-Tr:ADH98058"
FT                   /db_xref="GOA:D6XXY5"
FT                   /db_xref="InterPro:IPR002872"
FT                   /db_xref="InterPro:IPR008219"
FT                   /db_xref="InterPro:IPR015659"
FT                   /db_xref="InterPro:IPR029041"
FT                   /db_xref="UniProtKB/TrEMBL:D6XXY5"
FT                   /inference="protein motif:PFAM:PF01619"
FT                   /protein_id="ADH98058.1"
FT                   /translation="MCLTQKEGLTAMITRNLFLFLSQNKYVKGKARKWGPKLGAHSLIA
FT                   GETIQEAMDTVRELNAKGLSATVDHLGEFVYTREEAEESANYCMRTLDAIAESGVDCNL
FT                   SLKLTSLGLDVDRNLCRDNMMAILETAEKHGGIFVRIDMEDYSHLDATLELLHELRQTY
FT                   TNVGTAVQGYLFRAEKDVDRLKGTNIRLIKGAYKESPEVVYQKQEDVDANYVKIIKRHM
FT                   LNGSYAAVATHDHNVIAEIKQFAEDNGIPREQFEFQMLYGFRTDMQEEIVKEGYKMRIY
FT                   VPFGEDWYGYYMRRMAERPQNIVFGVRGLLSK"
     MCLTQKEGLT AMITRNLFLF LSQNKYVKGK ARKWGPKLGA HSLIAGETIQ EAMDTVRELN        60
     AKGLSATVDH LGEFVYTREE AEESANYCMR TLDAIAESGV DCNLSLKLTS LGLDVDRNLC       120
     RDNMMAILET AEKHGGIFVR IDMEDYSHLD ATLELLHELR QTYTNVGTAV QGYLFRAEKD       180
     VDRLKGTNIR LIKGAYKESP EVVYQKQEDV DANYVKIIKR HMLNGSYAAV ATHDHNVIAE       240
     IKQFAEDNGI PREQFEFQML YGFRTDMQEE IVKEGYKMRI YVPFGEDWYG YYMRRMAERP       300
     QNIVFGVRGL LSK                                                          313
//

If you have problems or comments...

PBIL Back to PBIL home page