(data stored in ACNUC7421 zone)

EMBL: CP001791.PE509

CP001791.PE509       Location/Qualifiers
FT   CDS             557523..558599
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0525"
FT                   /product="extracellular solute-binding protein family 1"
FT                   /note="PFAM: extracellular solute-binding protein family 1;
FT                   KEGG: mxa:MXAN_0770 iron ABC transporter, periplasmic
FT                   iron-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0525"
FT                   /db_xref="EnsemblGenomes-Tr:ADH98061"
FT                   /db_xref="GOA:D6XXY8"
FT                   /db_xref="InterPro:IPR006061"
FT                   /db_xref="InterPro:IPR026045"
FT                   /db_xref="UniProtKB/TrEMBL:D6XXY8"
FT                   /inference="protein motif:PFAM:PF01547"
FT                   /protein_id="ADH98061.1"
FT                   /translation="MKKGFLLSAAILPGFMLAACGNDGNNETGSNEANDNEVVEAGGEL
FT                   VVYSARNETFVQALLDKFEEDTGIEVLALHGAEPLQIQEEAGNVQADIFISNDLGGLEY
FT                   LNQQDLLEGGDYENVDSIDEQYRAENNEWIALSSRARGFIYNKDMIAEEDVPQSMEDLF
FT                   DPSYADVENGYAITRGGNGGMIGNVSALRYEWGDERTQEWIETIQENASGIMQGHGDIR
FT                   RAVGAGEHSFGLVNNYYYHQQLEEPDNNNVGFVYPDQEDGQMGAITNAAGLGKVAGGPN
FT                   GDNGDRFMNWILEEENQLAFVGESLEVPINPDLEPPFEGAVRIADLNLQDMPLRELGNF
FT                   FEDTRSLIEDAGLDLELR"
     MKKGFLLSAA ILPGFMLAAC GNDGNNETGS NEANDNEVVE AGGELVVYSA RNETFVQALL        60
     DKFEEDTGIE VLALHGAEPL QIQEEAGNVQ ADIFISNDLG GLEYLNQQDL LEGGDYENVD       120
     SIDEQYRAEN NEWIALSSRA RGFIYNKDMI AEEDVPQSME DLFDPSYADV ENGYAITRGG       180
     NGGMIGNVSA LRYEWGDERT QEWIETIQEN ASGIMQGHGD IRRAVGAGEH SFGLVNNYYY       240
     HQQLEEPDNN NVGFVYPDQE DGQMGAITNA AGLGKVAGGP NGDNGDRFMN WILEEENQLA       300
     FVGESLEVPI NPDLEPPFEG AVRIADLNLQ DMPLRELGNF FEDTRSLIED AGLDLELR         358
//

If you have problems or comments...

PBIL Back to PBIL home page