(data stored in ACNUC7421 zone)

EMBL: CP001791.PE510

CP001791.PE510       Location/Qualifiers
FT   CDS             558630..560324
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0526"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: mxa:MXAN_0771 iron ABC
FT                   transporter, permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0526"
FT                   /db_xref="EnsemblGenomes-Tr:ADH98062"
FT                   /db_xref="GOA:D6XXY9"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:D6XXY9"
FT                   /inference="protein motif:PFAM:PF00528"
FT                   /protein_id="ADH98062.1"
FT                   /translation="MTTNHHDKNHDQTNKEMHTEEQKVEGKKPSTILRFMNRRWMDHWS
FT                   GNPPGPILLLIGIVTAILMSVPILYVIWRAVFAGADSWARLLGNRIPGLIWDTLSLVVA
FT                   VTAAAITIGVSVAWLVVRTDLPGRKWLQWMMALPLVIPPYVGAVTYIIVFGPSGWARDL
FT                   WEQSFLDSIIAYPINIYSFWGVFITLTLFTYPYVFLIASASLRKMNKSFEEVARSQGMS
FT                   TAQIFFKVNLPLLRPAIGAGAILISLYVLSDFGAIAMLRYVTFTAAIYYQRAGFDIPAA
FT                   SVLSLVLIVITVLILWLESYTRRKNKYYQTTNSYKEPDILSLGKWKPIATLYIGTVFSL
FT                   AVVLPISVLVYWTVIGAGAGAIDSRFFGFAWNSIKVSGLAAVISMLLATPIIYLKSRHP
FT                   SLTSSTIDKLSYGGYALPGVIVALGLVFIFNNHIPMLYNTFYMIAVAFVVRFLPQAMQA
FT                   GDASLSLVSPRMDEAARSLGYPAWKVMFKVVLPTIMPGVLAGGALVFVSSIKELPATLM
FT                   LRPPGFDTLAVRVYYEASEAIYHQAAPGALLIVLVSIIPLHYLLKKY"
     MTTNHHDKNH DQTNKEMHTE EQKVEGKKPS TILRFMNRRW MDHWSGNPPG PILLLIGIVT        60
     AILMSVPILY VIWRAVFAGA DSWARLLGNR IPGLIWDTLS LVVAVTAAAI TIGVSVAWLV       120
     VRTDLPGRKW LQWMMALPLV IPPYVGAVTY IIVFGPSGWA RDLWEQSFLD SIIAYPINIY       180
     SFWGVFITLT LFTYPYVFLI ASASLRKMNK SFEEVARSQG MSTAQIFFKV NLPLLRPAIG       240
     AGAILISLYV LSDFGAIAML RYVTFTAAIY YQRAGFDIPA ASVLSLVLIV ITVLILWLES       300
     YTRRKNKYYQ TTNSYKEPDI LSLGKWKPIA TLYIGTVFSL AVVLPISVLV YWTVIGAGAG       360
     AIDSRFFGFA WNSIKVSGLA AVISMLLATP IIYLKSRHPS LTSSTIDKLS YGGYALPGVI       420
     VALGLVFIFN NHIPMLYNTF YMIAVAFVVR FLPQAMQAGD ASLSLVSPRM DEAARSLGYP       480
     AWKVMFKVVL PTIMPGVLAG GALVFVSSIK ELPATLMLRP PGFDTLAVRV YYEASEAIYH       540
     QAAPGALLIV LVSIIPLHYL LKKY                                              564
//

If you have problems or comments...

PBIL Back to PBIL home page