(data stored in ACNUC7421 zone)

EMBL: CP001791.PE514

CP001791.PE514       Location/Qualifiers
FT   CDS             563205..564422
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0530"
FT                   /product="alanine racemase"
FT                   /EC_number="5.1.1.1"
FT                   /note="TIGRFAM: alanine racemase; KEGG: dds:Ddes_0171
FT                   alanine racemase; PFAM: alanine racemase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0530"
FT                   /db_xref="EnsemblGenomes-Tr:ADH98066"
FT                   /db_xref="GOA:D6XXZ3"
FT                   /db_xref="InterPro:IPR000821"
FT                   /db_xref="InterPro:IPR001608"
FT                   /db_xref="InterPro:IPR009006"
FT                   /db_xref="InterPro:IPR011079"
FT                   /db_xref="InterPro:IPR020622"
FT                   /db_xref="InterPro:IPR029066"
FT                   /db_xref="UniProtKB/TrEMBL:D6XXZ3"
FT                   /inference="protein motif:TFAM:TIGR00492"
FT                   /protein_id="ADH98066.1"
FT                   /translation="MKQIQEIYRKAGDQAVDVTHPFYRDTWAEIDLNAIHDNVTAIKAS
FT                   LPAHTEMMAVVKANAYGHGAVDVAREALDAGATYLGVAILDEAIALRKAGIGAPILVLG
FT                   YIRAEDILIASELDIAVTVFQKDWLEKAESLLRAAGRKAVCHVKLDSGMGRIGLRKEEE
FT                   IRELAEVLKASLHIHVEGAYTHMAAADEPGNDYYHVQKERFLDMMDWLESSLGEKVKIR
FT                   HCANSASALRFHEESCNLVRVGISMYGMAPSVEMKPDMKVPLKQAMSLKSRITQVKLLE
FT                   PGEGISYGSTYRTSGHEWIGTVPIGYADGWIRAHQSGDVLVKGKRAKIVGRICMDQMMI
FT                   LLDGPVETGTEVTLIGEDGGSFLSMDEVAGRIDTISYEIPCTLSYRVPRAVRKDGRVLY
FT                   VHNDIF"
     MKQIQEIYRK AGDQAVDVTH PFYRDTWAEI DLNAIHDNVT AIKASLPAHT EMMAVVKANA        60
     YGHGAVDVAR EALDAGATYL GVAILDEAIA LRKAGIGAPI LVLGYIRAED ILIASELDIA       120
     VTVFQKDWLE KAESLLRAAG RKAVCHVKLD SGMGRIGLRK EEEIRELAEV LKASLHIHVE       180
     GAYTHMAAAD EPGNDYYHVQ KERFLDMMDW LESSLGEKVK IRHCANSASA LRFHEESCNL       240
     VRVGISMYGM APSVEMKPDM KVPLKQAMSL KSRITQVKLL EPGEGISYGS TYRTSGHEWI       300
     GTVPIGYADG WIRAHQSGDV LVKGKRAKIV GRICMDQMMI LLDGPVETGT EVTLIGEDGG       360
     SFLSMDEVAG RIDTISYEIP CTLSYRVPRA VRKDGRVLYV HNDIF                       405
//

If you have problems or comments...

PBIL Back to PBIL home page