(data stored in ACNUC7421 zone)

EMBL: CP001791.PE517

CP001791.PE517       Location/Qualifiers
FT   CDS             565403..566263
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0533"
FT                   /product="anti-sigma-factor antagonist"
FT                   /note="PFAM: Rsbr domain protein; Sulfate
FT                   transporter/antisigma-factor antagonist STAS; KEGG:
FT                   bxe:Bxe_B2486 anti-sigma-factor antagonist
FT                   domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0533"
FT                   /db_xref="EnsemblGenomes-Tr:ADH98069"
FT                   /db_xref="GOA:D6XXZ6"
FT                   /db_xref="InterPro:IPR002645"
FT                   /db_xref="InterPro:IPR012292"
FT                   /db_xref="InterPro:IPR014792"
FT                   /db_xref="InterPro:IPR036513"
FT                   /db_xref="UniProtKB/TrEMBL:D6XXZ6"
FT                   /inference="protein motif:PFAM:PF08678"
FT                   /protein_id="ADH98069.1"
FT                   /translation="MNTFVKESILEQRSAIMNRWIEEIESFRTDDSLQNISNTVYENTN
FT                   REFIDKLFGAIEEGHTKVDRPLDDFAERLIQLGWPLHYLTRGLQEFRKVTIEILSETDS
FT                   DYCQSIEFFQDIESWIDDMVNMLVNQYSGSWENTVFLQKMALKELSAPLIPVFDRISVM
FT                   PLIGTIDTERAKLIMENLLDGVIEHRSQVVLIDITGVPVVDTMVAHHIIQASEAVRLVG
FT                   AKCILVGIRPEIAQTIVNLGIDLGKFPTKSTLKKGIEAALEMTQREIIEFDSVKGGEII
FT                   ADSNT"
     MNTFVKESIL EQRSAIMNRW IEEIESFRTD DSLQNISNTV YENTNREFID KLFGAIEEGH        60
     TKVDRPLDDF AERLIQLGWP LHYLTRGLQE FRKVTIEILS ETDSDYCQSI EFFQDIESWI       120
     DDMVNMLVNQ YSGSWENTVF LQKMALKELS APLIPVFDRI SVMPLIGTID TERAKLIMEN       180
     LLDGVIEHRS QVVLIDITGV PVVDTMVAHH IIQASEAVRL VGAKCILVGI RPEIAQTIVN       240
     LGIDLGKFPT KSTLKKGIEA ALEMTQREII EFDSVKGGEI IADSNT                      286
//

If you have problems or comments...

PBIL Back to PBIL home page