(data stored in ACNUC7421 zone)

EMBL: CP001791.PE520

CP001791.PE520       Location/Qualifiers
FT   CDS             567033..568046
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0536"
FT                   /product="protein serine/threonine phosphatase"
FT                   /EC_number="3.1.3.3"
FT                   /note="PFAM: Stage II sporulation E family protein;
FT                   Phosphoserine phosphatase RsbU; KEGG: geo:Geob_2606 protein
FT                   serine phosphatase with GAF(s) sensor(s); SMART: protein
FT                   phosphatase 2C domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0536"
FT                   /db_xref="EnsemblGenomes-Tr:ADH98072"
FT                   /db_xref="GOA:D6XXZ9"
FT                   /db_xref="InterPro:IPR001932"
FT                   /db_xref="InterPro:IPR014787"
FT                   /db_xref="InterPro:IPR017944"
FT                   /db_xref="InterPro:IPR036457"
FT                   /db_xref="UniProtKB/TrEMBL:D6XXZ9"
FT                   /inference="protein motif:PRIAM:3.1.3.3"
FT                   /protein_id="ADH98072.1"
FT                   /translation="MRDTKYSLYQMYKEMLTSYLDTKNEQALYHAQQFSKEMMEKDMSP
FT                   EETVSLHLSVFQELATELPEEVVDSFDLLLEVMVGYGLAYREHQSLRDRQRELDSELNV
FT                   ASRMQQSLLPHQEIGLDTIDLGVVSVPAGKMSGDYYHYMTDERDNVAIAVADVIGKGIP
FT                   AAMSMSMIKYAMDTLTEQSLRPRSILEKLNRVVERNIESDMFITMMYGFYDTNIHRFSM
FT                   ASAGHEPGFLYRSESDSFEDLEAKGLVLGVSPKVSYEEIIYDIQVGDFIVLLSDGVTEC
FT                   RIDGEFIRRDQVMDMIRERKDLEAQEIVDSIYYELERAQGFQLRDDFTLLILKRKV"
     MRDTKYSLYQ MYKEMLTSYL DTKNEQALYH AQQFSKEMME KDMSPEETVS LHLSVFQELA        60
     TELPEEVVDS FDLLLEVMVG YGLAYREHQS LRDRQRELDS ELNVASRMQQ SLLPHQEIGL       120
     DTIDLGVVSV PAGKMSGDYY HYMTDERDNV AIAVADVIGK GIPAAMSMSM IKYAMDTLTE       180
     QSLRPRSILE KLNRVVERNI ESDMFITMMY GFYDTNIHRF SMASAGHEPG FLYRSESDSF       240
     EDLEAKGLVL GVSPKVSYEE IIYDIQVGDF IVLLSDGVTE CRIDGEFIRR DQVMDMIRER       300
     KDLEAQEIVD SIYYELERAQ GFQLRDDFTL LILKRKV                                337
//

If you have problems or comments...

PBIL Back to PBIL home page