(data stored in ACNUC7421 zone)

EMBL: CP001791.PE526

CP001791.PE526       Location/Qualifiers
FT   CDS             572759..573241
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0542"
FT                   /product="protein of unknown function DUF335 SprT"
FT                   /note="KEGG: SPRT-like metalloprotease; PFAM: protein of
FT                   unknown function DUF335 SprT; SMART: protein of unknown
FT                   function SprT"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0542"
FT                   /db_xref="EnsemblGenomes-Tr:ADH98078"
FT                   /db_xref="GOA:D6XY05"
FT                   /db_xref="InterPro:IPR006640"
FT                   /db_xref="InterPro:IPR023524"
FT                   /db_xref="UniProtKB/TrEMBL:D6XY05"
FT                   /inference="protein motif:PFAM:PF03926"
FT                   /protein_id="ADH98078.1"
FT                   /translation="MTENELQRLTEQLSAEFFGKPFRHRITFNKRLRTTGGRYLLKSHH
FT                   IEINPGHYETFGKNELIGIIKHELCHYHLHIEGRGYRHQDAEFKRLLKETGASRHCRLI
FT                   PGARLRSTKLHIYHCGACRQVYERKRRMDVKKFACGRCGGKLKFIKTLSAETIDGI"
     MTENELQRLT EQLSAEFFGK PFRHRITFNK RLRTTGGRYL LKSHHIEINP GHYETFGKNE        60
     LIGIIKHELC HYHLHIEGRG YRHQDAEFKR LLKETGASRH CRLIPGARLR STKLHIYHCG       120
     ACRQVYERKR RMDVKKFACG RCGGKLKFIK TLSAETIDGI                             160
//

If you have problems or comments...

PBIL Back to PBIL home page