(data stored in ACNUC7421 zone)

EMBL: CP001791.PE527

CP001791.PE527       Location/Qualifiers
FT   CDS             579601..580959
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0543"
FT                   /product="cytochrome bd ubiquinol oxidase subunit I"
FT                   /note="PFAM: cytochrome bd ubiquinol oxidase subunit I;
FT                   KEGG: dde:Dde_3204 cytochrome d ubiquinol oxidase, subunit
FT                   I"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0543"
FT                   /db_xref="EnsemblGenomes-Tr:ADH98079"
FT                   /db_xref="GOA:D6XY06"
FT                   /db_xref="InterPro:IPR002585"
FT                   /db_xref="UniProtKB/TrEMBL:D6XY06"
FT                   /inference="protein motif:PFAM:PF01654"
FT                   /protein_id="ADH98079.1"
FT                   /translation="MLDVLLLSRLQFTFTAVVHYIFIPLTIGLAVFIAYMEFRYWRTKD
FT                   PLYDKMARFWTKLFLINFGVGVATGITMEFQFGTNWAAYSRFVGDVFGAPLAAEGVFAF
FT                   FLESTFIGLLVFGRDKISRGMRFFAALMVAVGTSLSGFWIIAANSWQQTPQGHIINEEL
FT                   NRAEMVSFAEVIFNPSTMVRYLHVMEGAFITAAMFIVAISAYFIIKKKNLPLAKRSMKM
FT                   GIVVGLVFSVLQAFSGHSHAQLVGETQPEKLAAYEAHWETEANAPLLLFAIPDHENERN
FT                   RFEIGIPGMLSFLTYDDVNAEVTGLKEFAAEDRPPVLGNFIAFRVMVTAGIILIGFFMV
FT                   MAWQWRKGNLFEKEKLMKTAFWMLPLPYIANTAGWIVAEWGRQPWAVFGVLRTEDAVSH
FT                   LTAVEVMISLGLFIAIYSFLVWLMVYLMKKEVRKFDMETSMKHLDHPKEGESA"
     MLDVLLLSRL QFTFTAVVHY IFIPLTIGLA VFIAYMEFRY WRTKDPLYDK MARFWTKLFL        60
     INFGVGVATG ITMEFQFGTN WAAYSRFVGD VFGAPLAAEG VFAFFLESTF IGLLVFGRDK       120
     ISRGMRFFAA LMVAVGTSLS GFWIIAANSW QQTPQGHIIN EELNRAEMVS FAEVIFNPST       180
     MVRYLHVMEG AFITAAMFIV AISAYFIIKK KNLPLAKRSM KMGIVVGLVF SVLQAFSGHS       240
     HAQLVGETQP EKLAAYEAHW ETEANAPLLL FAIPDHENER NRFEIGIPGM LSFLTYDDVN       300
     AEVTGLKEFA AEDRPPVLGN FIAFRVMVTA GIILIGFFMV MAWQWRKGNL FEKEKLMKTA       360
     FWMLPLPYIA NTAGWIVAEW GRQPWAVFGV LRTEDAVSHL TAVEVMISLG LFIAIYSFLV       420
     WLMVYLMKKE VRKFDMETSM KHLDHPKEGE SA                                     452
//

If you have problems or comments...

PBIL Back to PBIL home page