(data stored in ACNUC7421 zone)

EMBL: CP001791.PE529

CP001791.PE529       Location/Qualifiers
FT   CDS             581983..583707
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0545"
FT                   /product="ABC transporter, CydDC cysteine exporter
FT                   (CydDC-E) family, permease/ATP-binding protein CydD"
FT                   /note="TIGRFAM: ABC transporter, CydDC cysteine exporter
FT                   (CydDC-E) family, permease/ATP-binding protein CydD; PFAM:
FT                   ABC transporter related; ABC transporter transmembrane
FT                   region; KEGG: pat:Patl_1455 ABC transporter related; SMART:
FT                   AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0545"
FT                   /db_xref="EnsemblGenomes-Tr:ADH98081"
FT                   /db_xref="GOA:D6XY08"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR014216"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="InterPro:IPR039421"
FT                   /db_xref="UniProtKB/TrEMBL:D6XY08"
FT                   /inference="protein motif:TFAM:TIGR02857"
FT                   /protein_id="ADH98081.1"
FT                   /translation="MMKKELNREAFAHKRRMFLLVLFTVLSGAVIIGQAFTIATFVDAV
FT                   FLQGEAVRDAAWLLALLFALFVARVLLSDLPFRIGIRIAKDVKDGYRKRLAEGMRTSEE
FT                   AGDVTGKRVSLYMDVVDEMDSYFSTYLPQLVQTMIVPVMILVTVFTQNIYSGIIMLVTA
FT                   PLIPVFMILIGGHSEKKAGVQMAKLQSFSGHFLDTLRGVMTLKLFGRTNVQRGVIKEKS
FT                   IAFREATMDVLKIAFLSALMLEILATIATAMIAVEVGLRLVFGHLAFQTGFFVLLMAPE
FT                   LYLPLKNLGASFHSGRNSIAAAEKLHGQFEEEGSNVSWGERTFQPVRPPAVDIRHLTYM
FT                   YPGGHQGIRQISTAIEGPGLFAIAGKSGAGKSTLVNLLAGLMDSQDGDILIDGHKRESY
FT                   TEVSWFNAVGYVSQKPYLFAGTMRSNIVMGRTDKTEEEILEAVHAAGLSEVVSQLPKGL
FT                   DTATGEQGEGFSGGERQRMALARVLLHRPKLIFFDEPTSGLDVGTERRMNDTIVRLSKE
FT                   ATVITIAHRTSTLQEAGRILLLENGSLIAQGSFDDLVAKSEVFRGIVGISGGGERDA"
     MMKKELNREA FAHKRRMFLL VLFTVLSGAV IIGQAFTIAT FVDAVFLQGE AVRDAAWLLA        60
     LLFALFVARV LLSDLPFRIG IRIAKDVKDG YRKRLAEGMR TSEEAGDVTG KRVSLYMDVV       120
     DEMDSYFSTY LPQLVQTMIV PVMILVTVFT QNIYSGIIML VTAPLIPVFM ILIGGHSEKK       180
     AGVQMAKLQS FSGHFLDTLR GVMTLKLFGR TNVQRGVIKE KSIAFREATM DVLKIAFLSA       240
     LMLEILATIA TAMIAVEVGL RLVFGHLAFQ TGFFVLLMAP ELYLPLKNLG ASFHSGRNSI       300
     AAAEKLHGQF EEEGSNVSWG ERTFQPVRPP AVDIRHLTYM YPGGHQGIRQ ISTAIEGPGL       360
     FAIAGKSGAG KSTLVNLLAG LMDSQDGDIL IDGHKRESYT EVSWFNAVGY VSQKPYLFAG       420
     TMRSNIVMGR TDKTEEEILE AVHAAGLSEV VSQLPKGLDT ATGEQGEGFS GGERQRMALA       480
     RVLLHRPKLI FFDEPTSGLD VGTERRMNDT IVRLSKEATV ITIAHRTSTL QEAGRILLLE       540
     NGSLIAQGSF DDLVAKSEVF RGIVGISGGG ERDA                                   574
//

If you have problems or comments...

PBIL Back to PBIL home page