(data stored in ACNUC7421 zone)

EMBL: CP001791.PE53

CP001791.PE53        Location/Qualifiers
FT   CDS             63130..63771
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0054"
FT                   /product="ribosomal 5S rRNA E-loop binding protein
FT                   Ctc/L25/TL5"
FT                   /note="KEGG: dat:HRM2_16820 RplY; TIGRFAM: ribosomal 5S
FT                   rRNA E-loop binding protein Ctc/L25/TL5; PFAM: Ribosomal
FT                   protein L25-like"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0054"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97605"
FT                   /db_xref="GOA:D6XV47"
FT                   /db_xref="InterPro:IPR001021"
FT                   /db_xref="InterPro:IPR011035"
FT                   /db_xref="InterPro:IPR020056"
FT                   /db_xref="InterPro:IPR020057"
FT                   /db_xref="InterPro:IPR029751"
FT                   /db_xref="InterPro:IPR037121"
FT                   /db_xref="UniProtKB/TrEMBL:D6XV47"
FT                   /inference="protein motif:TFAM:TIGR00731"
FT                   /protein_id="ADH97605.1"
FT                   /translation="MATILKAAPRNEMKGSTLTTIRSAGWIPAVVYGKEYGNKPVQVEE
FT                   IDFIKTYRAEGKTGVFSLDVEGEKTDVMIYDIQYDMMKNQYVHIDFYAANMKEEMDADV
FT                   PVNVVGEAQGVKDGGVLQQGVFELSVRALPKELPDSIDVNVEELEVNDSIFVKDLKSGA
FT                   DFEFNNDPEEMVVSIVPPTDEPEEETAEEEEGAEPELVAGEEGEEENMEE"
     MATILKAAPR NEMKGSTLTT IRSAGWIPAV VYGKEYGNKP VQVEEIDFIK TYRAEGKTGV        60
     FSLDVEGEKT DVMIYDIQYD MMKNQYVHID FYAANMKEEM DADVPVNVVG EAQGVKDGGV       120
     LQQGVFELSV RALPKELPDS IDVNVEELEV NDSIFVKDLK SGADFEFNND PEEMVVSIVP       180
     PTDEPEEETA EEEEGAEPEL VAGEEGEEEN MEE                                    213
//

If you have problems or comments...

PBIL Back to PBIL home page