(data stored in ACNUC7421 zone)

EMBL: CP001791.PE530

CP001791.PE530       Location/Qualifiers
FT   CDS             583700..585412
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0546"
FT                   /product="ABC transporter, CydDC cysteine exporter
FT                   (CydDC-E) family, permease/ATP-binding protein CydC"
FT                   /note="TIGRFAM: ABC transporter, CydDC cysteine exporter
FT                   (CydDC-E) family, permease/ATP-binding protein CydC; PFAM:
FT                   ABC transporter related; KEGG: ses:SARI_02008
FT                   cysteine/glutathione ABC transporter membrane/ATP-binding
FT                   component; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0546"
FT                   /db_xref="EnsemblGenomes-Tr:ADH98082"
FT                   /db_xref="GOA:D6XY09"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR014223"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="UniProtKB/TrEMBL:D6XY09"
FT                   /inference="protein motif:TFAM:TIGR02868"
FT                   /protein_id="ADH98082.1"
FT                   /translation="MRDIKPVLKLMLLEKKEVLLAALLGFLAAGASVGLLASSGFLISS
FT                   AALQPPLYTLTASIVLVRFFGLLRAGSRYGERYFSHKATFTILSHIRTHYFDQVVARIP
FT                   GLFRSKRSGDLLSRITGDVENLQFFFLRVVYPPVVMVLVFLATIFFASLYSFYAAVLLF
FT                   TGFILTGGVIPAWFAWKTRQKAGRVRETRGALSTEVTEFMTGYRELKIHGQTKVKSEDV
FT                   QSLAKAYTSLQQDEQHQLAGSESVNIFAGLMITWLIAFLAALEVQNGSLDGVWLAAMIL
FT                   VSLSVFESANPMASFPKNYESGRQSAERLSLSEGDATDQNGQQGQALSDAIDTIAFKDV
FT                   SFSHEGSERFALSEVSALFKRGQRTAIVGASGSGKTTLMEVLLGIHMADRGDVLVNGQR
FT                   LGDLDLDSCWSQFSFSLQDNHFFYGSIRENLEVPGTGAADQEMTDILERLSLSHLTLDD
FT                   QLEEGAGNLSGGERQRLALARAWLRNGAVWLLDEPLSALDANTYDKVIKEVFDVSAKSM
FT                   MILITHQLRGLEQMDQILVMDQGRIVERGSYHDLMAQKGWFYALHEVDKQMIG"
     MRDIKPVLKL MLLEKKEVLL AALLGFLAAG ASVGLLASSG FLISSAALQP PLYTLTASIV        60
     LVRFFGLLRA GSRYGERYFS HKATFTILSH IRTHYFDQVV ARIPGLFRSK RSGDLLSRIT       120
     GDVENLQFFF LRVVYPPVVM VLVFLATIFF ASLYSFYAAV LLFTGFILTG GVIPAWFAWK       180
     TRQKAGRVRE TRGALSTEVT EFMTGYRELK IHGQTKVKSE DVQSLAKAYT SLQQDEQHQL       240
     AGSESVNIFA GLMITWLIAF LAALEVQNGS LDGVWLAAMI LVSLSVFESA NPMASFPKNY       300
     ESGRQSAERL SLSEGDATDQ NGQQGQALSD AIDTIAFKDV SFSHEGSERF ALSEVSALFK       360
     RGQRTAIVGA SGSGKTTLME VLLGIHMADR GDVLVNGQRL GDLDLDSCWS QFSFSLQDNH       420
     FFYGSIRENL EVPGTGAADQ EMTDILERLS LSHLTLDDQL EEGAGNLSGG ERQRLALARA       480
     WLRNGAVWLL DEPLSALDAN TYDKVIKEVF DVSAKSMMIL ITHQLRGLEQ MDQILVMDQG       540
     RIVERGSYHD LMAQKGWFYA LHEVDKQMIG                                        570
//

If you have problems or comments...

PBIL Back to PBIL home page