(data stored in ACNUC7421 zone)

EMBL: CP001791.PE533

CP001791.PE533       Location/Qualifiers
FT   CDS             587901..588362
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0549"
FT                   /product="protein of unknown function UPF0079"
FT                   /note="PFAM: protein of unknown function UPF0079; KEGG:
FT                   gme:Gmet_1881 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0549"
FT                   /db_xref="EnsemblGenomes-Tr:ADH98085"
FT                   /db_xref="GOA:D6XY12"
FT                   /db_xref="InterPro:IPR003442"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D6XY12"
FT                   /inference="protein motif:PFAM:PF02367"
FT                   /protein_id="ADH98085.1"
FT                   /translation="MALQRKFMVHSVDETRELAEKLAGKLTPDTVLTLEGDLGAGKTTF
FT                   TKALAKALGVEGTVNSPTFTIMKEYVGTMPFYHMDAYRIEDEGEDFGLDEYFNGGGVTV
FT                   IEWPSMIQSQLPSSRIDMTIIYRGPDTREIVLVGNGRDYIQVVKELSGK"
     MALQRKFMVH SVDETRELAE KLAGKLTPDT VLTLEGDLGA GKTTFTKALA KALGVEGTVN        60
     SPTFTIMKEY VGTMPFYHMD AYRIEDEGED FGLDEYFNGG GVTVIEWPSM IQSQLPSSRI       120
     DMTIIYRGPD TREIVLVGNG RDYIQVVKEL SGK                                    153
//

If you have problems or comments...

PBIL Back to PBIL home page