(data stored in ACNUC7421 zone)

EMBL: CP001791.PE534

CP001791.PE534       Location/Qualifiers
FT   CDS             588359..589075
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0550"
FT                   /product="peptidase M22 glycoprotease"
FT                   /note="PFAM: peptidase M22 glycoprotease; KEGG:
FT                   sat:SYN_00914 M22 family non-proteolytic peptidase"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0550"
FT                   /db_xref="EnsemblGenomes-Tr:ADH98086"
FT                   /db_xref="GOA:D6XY13"
FT                   /db_xref="InterPro:IPR000905"
FT                   /db_xref="InterPro:IPR022496"
FT                   /db_xref="UniProtKB/TrEMBL:D6XY13"
FT                   /inference="protein motif:PFAM:PF00814"
FT                   /protein_id="ADH98086.1"
FT                   /translation="MNVLAIDTASYVLGVGLLKDGKPLGSIVTHEKKNHSLRLMPAIRS
FT                   LFEEVDMTPKDLDRIVVDHGPGSYTGVRIGVTTAKTMAYSLNIPVVGVSSLEALAANGS
FT                   LFTGETVPFFDARRGQVFTGLYEQGTSILEDRIIMLDEWLQILSERDTPKYLFISPDAM
FT                   QHRTLIESALGERAVMAPAPSEIVRPEALALIGMTKEADESVHGFTPNYLRLAEAESKW
FT                   REANPGKVKTYGGSGN"
     MNVLAIDTAS YVLGVGLLKD GKPLGSIVTH EKKNHSLRLM PAIRSLFEEV DMTPKDLDRI        60
     VVDHGPGSYT GVRIGVTTAK TMAYSLNIPV VGVSSLEALA ANGSLFTGET VPFFDARRGQ       120
     VFTGLYEQGT SILEDRIIML DEWLQILSER DTPKYLFISP DAMQHRTLIE SALGERAVMA       180
     PAPSEIVRPE ALALIGMTKE ADESVHGFTP NYLRLAEAES KWREANPGKV KTYGGSGN         238
//

If you have problems or comments...

PBIL Back to PBIL home page