(data stored in ACNUC7421 zone)

EMBL: CP001791.PE535

CP001791.PE535       Location/Qualifiers
FT   CDS             589056..589526
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0551"
FT                   /product="ribosomal-protein-alanine acetyltransferase"
FT                   /note="KEGG: ppd:Ppro_2631 ribosomal-protein-alanine
FT                   acetyltransferase; TIGRFAM: ribosomal-protein-alanine
FT                   acetyltransferase; PFAM: GCN5-related N-acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0551"
FT                   /db_xref="EnsemblGenomes-Tr:ADH98087"
FT                   /db_xref="GOA:D6XY14"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR006464"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:D6XY14"
FT                   /inference="protein motif:TFAM:TIGR01575"
FT                   /protein_id="ADH98087.1"
FT                   /translation="MADQETEKAGVRIRFMDVTDLDGVLELENRTFSTPWSRDAFYNEI
FT                   VKNQFAYYTVAESAEGAIVGYCGLWVIIDDAHITNIAVDPEWRREGIGERMMSEAMAFA
FT                   KKRGAERLSLEVRVSNTAAQAMYRKYGLQDGGIRKQYYTDNQEDALVMWVRL"
     MADQETEKAG VRIRFMDVTD LDGVLELENR TFSTPWSRDA FYNEIVKNQF AYYTVAESAE        60
     GAIVGYCGLW VIIDDAHITN IAVDPEWRRE GIGERMMSEA MAFAKKRGAE RLSLEVRVSN       120
     TAAQAMYRKY GLQDGGIRKQ YYTDNQEDAL VMWVRL                                 156
//

If you have problems or comments...

PBIL Back to PBIL home page