(data stored in ACNUC7421 zone)

EMBL: CP001791.PE536

CP001791.PE536       Location/Qualifiers
FT   CDS             589757..592072
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0552"
FT                   /product="metalloendopeptidase, glycoprotease family"
FT                   /EC_number="3.4.24.57"
FT                   /note="SMART: HNH nuclease; TIGRFAM: metalloendopeptidase,
FT                   glycoprotease family; KEGG: gur:Gura_2310
FT                   metalloendopeptidase glycoprotease family; PFAM: peptidase
FT                   M22 glycoprotease; HNH endonuclease"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0552"
FT                   /db_xref="EnsemblGenomes-Tr:ADH98088"
FT                   /db_xref="GOA:D6XY15"
FT                   /db_xref="InterPro:IPR000905"
FT                   /db_xref="InterPro:IPR002711"
FT                   /db_xref="InterPro:IPR003615"
FT                   /db_xref="InterPro:IPR017860"
FT                   /db_xref="InterPro:IPR017861"
FT                   /db_xref="InterPro:IPR022450"
FT                   /db_xref="InterPro:IPR025938"
FT                   /db_xref="UniProtKB/TrEMBL:D6XY15"
FT                   /inference="protein motif:TFAM:TIGR00329"
FT                   /protein_id="ADH98088.1"
FT                   /translation="MFVYVLNKNGEPLMPCKPRKARLLLNEKKAKVVKQTPFTIQLLYG
FT                   SSGYKQPVSLGVDAGTKHIGFSATTEKDVLFEGDVQLRTDIQDKLATRRQYRRSRRSRK
FT                   TRYRQPRFDNRKKEKGWLAPSVQHKVDSHIRFVEKVHALLPITTITVEVAQFDIQKIKK
FT                   PEIEGEGYQQGDQFGFWNVREYVFFRDNHRCQHCKGKSKDKILNVHHIESRKTGGDSPD
FT                   NLLTLCETCHKKIHREGLEHLFQRKRTPLRDASQMAVMRWFIYNGLKARYPDAKLTYGY
FT                   LTKNTRIEHSLEKSHAVDARCISGHPTAKPSEATYQYKQVRKNNRQLHKTTILKGGIRK
FT                   ANKAERFVKGFQLFDKVLCEGQPCFIFGRRKTGSFDLRLLDGTVISRGKSYKKIALKEK
FT                   ATSWLVERSETVHRKPPNSFGGFLWTYLMKNQTEGLILAIETSCDETAAAVIKNGNAIL
FT                   SNVVASQIDSHKRFGGVVPEIASRHHVDQMTLTIDEAIHQAGVTLEDLDAIAVTEGPGL
FT                   IGALLVGVHAAKALSFTLGIPLIGVHHIAGHIYANHLTEPLTYPLVSLVVSGGHTELIY
FT                   MEADGTYELMGETRDDAVGEAYDKVARTLGLPYPGGPQIDRLAKEGEATIDLPRAWLEE
FT                   GSFDFSFSGLKSAVINTLHNAKQKGQTIPMADLAASFQASVIDVLVDKTIRAVKERGVD
FT                   RLVIAGGVAANSGLREALMAASEEAGIRLTIPPIHLCTDNAAMIGAAAFVQYRRGVFSD
FT                   DRMNGNPGLELKTVTKAE"
     MFVYVLNKNG EPLMPCKPRK ARLLLNEKKA KVVKQTPFTI QLLYGSSGYK QPVSLGVDAG        60
     TKHIGFSATT EKDVLFEGDV QLRTDIQDKL ATRRQYRRSR RSRKTRYRQP RFDNRKKEKG       120
     WLAPSVQHKV DSHIRFVEKV HALLPITTIT VEVAQFDIQK IKKPEIEGEG YQQGDQFGFW       180
     NVREYVFFRD NHRCQHCKGK SKDKILNVHH IESRKTGGDS PDNLLTLCET CHKKIHREGL       240
     EHLFQRKRTP LRDASQMAVM RWFIYNGLKA RYPDAKLTYG YLTKNTRIEH SLEKSHAVDA       300
     RCISGHPTAK PSEATYQYKQ VRKNNRQLHK TTILKGGIRK ANKAERFVKG FQLFDKVLCE       360
     GQPCFIFGRR KTGSFDLRLL DGTVISRGKS YKKIALKEKA TSWLVERSET VHRKPPNSFG       420
     GFLWTYLMKN QTEGLILAIE TSCDETAAAV IKNGNAILSN VVASQIDSHK RFGGVVPEIA       480
     SRHHVDQMTL TIDEAIHQAG VTLEDLDAIA VTEGPGLIGA LLVGVHAAKA LSFTLGIPLI       540
     GVHHIAGHIY ANHLTEPLTY PLVSLVVSGG HTELIYMEAD GTYELMGETR DDAVGEAYDK       600
     VARTLGLPYP GGPQIDRLAK EGEATIDLPR AWLEEGSFDF SFSGLKSAVI NTLHNAKQKG       660
     QTIPMADLAA SFQASVIDVL VDKTIRAVKE RGVDRLVIAG GVAANSGLRE ALMAASEEAG       720
     IRLTIPPIHL CTDNAAMIGA AAFVQYRRGV FSDDRMNGNP GLELKTVTKA E                771
//

If you have problems or comments...

PBIL Back to PBIL home page