(data stored in ACNUC7421 zone)

EMBL: CP001791.PE537

CP001791.PE537       Location/Qualifiers
FT   CDS             complement(592710..594638)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0553"
FT                   /product="ABC transporter related protein"
FT                   /note="KEGG: pca:Pcar_2038 ABC-type transport system,
FT                   ATPase component; PFAM: ABC transporter related; SMART: AAA
FT                   ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0553"
FT                   /db_xref="EnsemblGenomes-Tr:ADH98089"
FT                   /db_xref="GOA:D6XY16"
FT                   /db_xref="InterPro:IPR001315"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032524"
FT                   /db_xref="InterPro:IPR032781"
FT                   /db_xref="UniProtKB/TrEMBL:D6XY16"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ADH98089.1"
FT                   /translation="MIVLQCSQLNKSFGTDTILNQVKLEVKSNERVALVGRNGAGKSTL
FT                   LKIIAGELTHDDGTLMIPKEVNVGYLAQDSGLNTDRSIWDEMMTVFSALRQMERKLRSL
FT                   EEEMSDPSNPRYEKILQDYDQLSQDFRDRGGFQYEADIRSILSGLNFSSFDYSTPIRSL
FT                   SGGQKTRLALGKLLLSKPELLILDEPTNHLDIDTMTWLESYLSGYSGALLIVSHDRYFL
FT                   DRIVNTVYELTFHQTYKYTGNYSHYLDEKAARLELEMKEFDKQQSEIKKLEDFVARNLA
FT                   RASTSNRAKSRRKKLEKMERLDRPVSEDESAKFRFDIERQTGNDVLMVDGLAIGYGDTP
FT                   LVSDVSFTITRGESVALIGPNGIGKTTLLKTIAGSLEALRGGVRYGSNVKIGYYDQEQT
FT                   GLNPKKTVLHELWDDYPLFPEKQIRTVLGNFLFTGDEVLKSVMDLSGGEKARLSLAKLM
FT                   MEKPNVLILDEPTNHLDLDSKEVLEDALIDYPGTLMFVSHDRYFINRMATKIIELSSDA
FT                   MTTYLGDYDYYQEKKEEQAAFLQLEEDQRNEARPDMDSHAADAQGKSGFMQQKEAQKAE
FT                   RQRLRRIEEIESTVEGHESRVEEIESELIKPEVFQDHEESARLQTELESLQDALETLMD
FT                   EWEALQD"
     MIVLQCSQLN KSFGTDTILN QVKLEVKSNE RVALVGRNGA GKSTLLKIIA GELTHDDGTL        60
     MIPKEVNVGY LAQDSGLNTD RSIWDEMMTV FSALRQMERK LRSLEEEMSD PSNPRYEKIL       120
     QDYDQLSQDF RDRGGFQYEA DIRSILSGLN FSSFDYSTPI RSLSGGQKTR LALGKLLLSK       180
     PELLILDEPT NHLDIDTMTW LESYLSGYSG ALLIVSHDRY FLDRIVNTVY ELTFHQTYKY       240
     TGNYSHYLDE KAARLELEMK EFDKQQSEIK KLEDFVARNL ARASTSNRAK SRRKKLEKME       300
     RLDRPVSEDE SAKFRFDIER QTGNDVLMVD GLAIGYGDTP LVSDVSFTIT RGESVALIGP       360
     NGIGKTTLLK TIAGSLEALR GGVRYGSNVK IGYYDQEQTG LNPKKTVLHE LWDDYPLFPE       420
     KQIRTVLGNF LFTGDEVLKS VMDLSGGEKA RLSLAKLMME KPNVLILDEP TNHLDLDSKE       480
     VLEDALIDYP GTLMFVSHDR YFINRMATKI IELSSDAMTT YLGDYDYYQE KKEEQAAFLQ       540
     LEEDQRNEAR PDMDSHAADA QGKSGFMQQK EAQKAERQRL RRIEEIESTV EGHESRVEEI       600
     ESELIKPEVF QDHEESARLQ TELESLQDAL ETLMDEWEAL QD                          642
//

If you have problems or comments...

PBIL Back to PBIL home page