(data stored in ACNUC7421 zone)

EMBL: CP001791.PE539

CP001791.PE539       Location/Qualifiers
FT   CDS             595299..595934
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0555"
FT                   /product="CoA-binding domain protein"
FT                   /note="PFAM: CoA-binding domain protein; Rex DNA-binding
FT                   domain protein; KEGG: dde:Dde_2702 redox-sensing
FT                   transcriptional repressor REX"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0555"
FT                   /db_xref="EnsemblGenomes-Tr:ADH98091"
FT                   /db_xref="GOA:D6XY18"
FT                   /db_xref="InterPro:IPR003781"
FT                   /db_xref="InterPro:IPR009718"
FT                   /db_xref="InterPro:IPR022876"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D6XY18"
FT                   /inference="protein motif:PFAM:PF02629"
FT                   /protein_id="ADH98091.1"
FT                   /translation="MEIDQAKIPQATAKRLPLYYRFLEGLQASGKHRVSSSELSEAVKV
FT                   DSATIRRDFSYFGALGKKGYGYNVNYLLSFFRKTLDQDELTKVALVGVGNLGTAFLNYN
FT                   FSKSNNTRIEMAFDVDRSKVDQVYGDVPVYHFDDIEEKIGDIEVVILTVPSQAAQGITD
FT                   QLLECGIKGILNFTPARLTVPDDIRVHHIDLSVELQSLIYFLKHYPLK"
     MEIDQAKIPQ ATAKRLPLYY RFLEGLQASG KHRVSSSELS EAVKVDSATI RRDFSYFGAL        60
     GKKGYGYNVN YLLSFFRKTL DQDELTKVAL VGVGNLGTAF LNYNFSKSNN TRIEMAFDVD       120
     RSKVDQVYGD VPVYHFDDIE EKIGDIEVVI LTVPSQAAQG ITDQLLECGI KGILNFTPAR       180
     LTVPDDIRVH HIDLSVELQS LIYFLKHYPL K                                      211
//

If you have problems or comments...

PBIL Back to PBIL home page