(data stored in ACNUC7421 zone)

EMBL: CP001791.PE540

CP001791.PE540       Location/Qualifiers
FT   CDS             596123..597529
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0556"
FT                   /product="drug resistance transporter, EmrB/QacA subfamily"
FT                   /note="KEGG: dze:Dd1591_2675 drug resistance transporter,
FT                   EmrB/QacA subfamily; TIGRFAM: drug resistance transporter,
FT                   EmrB/QacA subfamily; PFAM: major facilitator superfamily
FT                   MFS_1"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0556"
FT                   /db_xref="EnsemblGenomes-Tr:ADH98092"
FT                   /db_xref="GOA:D6XY19"
FT                   /db_xref="InterPro:IPR004638"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:D6XY19"
FT                   /inference="protein motif:TFAM:TIGR00711"
FT                   /protein_id="ADH98092.1"
FT                   /translation="MFTNIPLKWLVVITVLTGTFTVILNNSMLNPAVPYFMQVFDADAV
FT                   SAGWVITIFMVAMGMSMPLTGYLADKFGKKQVYIAGLLLFVTGSVLGSMAWDISAIILF
FT                   RALQGVGGGMIMPLSMVLIFDAFPREERGLATGVWGVAAMLAPTIGPTLGGVIVELGSW
FT                   QWLFLVNIPTGLLAVFFSLKFLPKAVKVTDIRLDKSGFVTVTIGVGAILFALGRMNELS
FT                   HLYNPVNLGLIAVGSLSLWLFVKIEAKQDQPLLDLSIFKIKAFTYSVIIAMVGSISLFG
FT                   GIFLIPLLVQNVYGYGAIVTGLSFLPSALMMGLFMNIGGRMLDVRGPTLAAAGGLIILS
FT                   VSTGAMGFLTMGTSLWLVFLLNGLRGVGLGLSNMPSTTAGMNSIPEKFVSRGSAMGNVI
FT                   RQMSSALGIVFVSIYFEVRRAQIMVNGGMDIESASLSAINEAFVALALITLITVPLGFK
FT                   LGREYQQKAG"
     MFTNIPLKWL VVITVLTGTF TVILNNSMLN PAVPYFMQVF DADAVSAGWV ITIFMVAMGM        60
     SMPLTGYLAD KFGKKQVYIA GLLLFVTGSV LGSMAWDISA IILFRALQGV GGGMIMPLSM       120
     VLIFDAFPRE ERGLATGVWG VAAMLAPTIG PTLGGVIVEL GSWQWLFLVN IPTGLLAVFF       180
     SLKFLPKAVK VTDIRLDKSG FVTVTIGVGA ILFALGRMNE LSHLYNPVNL GLIAVGSLSL       240
     WLFVKIEAKQ DQPLLDLSIF KIKAFTYSVI IAMVGSISLF GGIFLIPLLV QNVYGYGAIV       300
     TGLSFLPSAL MMGLFMNIGG RMLDVRGPTL AAAGGLIILS VSTGAMGFLT MGTSLWLVFL       360
     LNGLRGVGLG LSNMPSTTAG MNSIPEKFVS RGSAMGNVIR QMSSALGIVF VSIYFEVRRA       420
     QIMVNGGMDI ESASLSAINE AFVALALITL ITVPLGFKLG REYQQKAG                    468
//

If you have problems or comments...

PBIL Back to PBIL home page