(data stored in ACNUC7421 zone)

EMBL: CP001791.PE541

CP001791.PE541       Location/Qualifiers
FT   CDS             597552..598544
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0557"
FT                   /product="protein of unknown function DUF534"
FT                   /note="PFAM: protein of unknown function DUF534; KEGG:
FT                   rle:pRL110111 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0557"
FT                   /db_xref="EnsemblGenomes-Tr:ADH98093"
FT                   /db_xref="InterPro:IPR007487"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:D6XY20"
FT                   /inference="protein motif:PFAM:PF04392"
FT                   /protein_id="ADH98093.1"
FT                   /translation="MRTVFVITGLMLLAAGLFWYTESLQADEPAHLGVLLTESSRLDKL
FT                   EGIENGLRDLGFHVEDDLVFHVYEEEEDTDALMAMAREMLEADYDLIAAFGGIEAQVLD
FT                   VAMEETGLSTPVVFVGMAAPLDTGLIESYERPGTMFTGVANHHLNLSAKRLELFTDALP
FT                   EMDEVIVLYNKEIDISNRSCDVTREAVETLGIEVVPFDVGTELDLTALADLAGENTGLL
FT                   TLPSFIIEGMTGELADFSRAHDLPVMGIYDDEVAEGFLMAYGSSFYDQGYQAARQISLI
FT                   LGGNEASTIPVELPDRLLFQVNRDTAAHIGVSLDRDVMRLADEVKGGGD"
     MRTVFVITGL MLLAAGLFWY TESLQADEPA HLGVLLTESS RLDKLEGIEN GLRDLGFHVE        60
     DDLVFHVYEE EEDTDALMAM AREMLEADYD LIAAFGGIEA QVLDVAMEET GLSTPVVFVG       120
     MAAPLDTGLI ESYERPGTMF TGVANHHLNL SAKRLELFTD ALPEMDEVIV LYNKEIDISN       180
     RSCDVTREAV ETLGIEVVPF DVGTELDLTA LADLAGENTG LLTLPSFIIE GMTGELADFS       240
     RAHDLPVMGI YDDEVAEGFL MAYGSSFYDQ GYQAARQISL ILGGNEASTI PVELPDRLLF       300
     QVNRDTAAHI GVSLDRDVMR LADEVKGGGD                                        330
//

If you have problems or comments...

PBIL Back to PBIL home page