(data stored in ACNUC7421 zone)

EMBL: CP001791.PE542

CP001791.PE542       Location/Qualifiers
FT   CDS             598544..600625
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0558"
FT                   /product="integral membrane sensor signal transduction
FT                   histidine kinase"
FT                   /note="KEGG: gur:Gura_3573 PAS/PAC sensor signal
FT                   transduction histidine kinase; PFAM: ATP-binding region
FT                   ATPase domain protein; histidine kinase A domain protein;
FT                   histidine kinase HAMP region domain protein; SMART:
FT                   ATP-binding region ATPase domain protein; histidine kinase
FT                   A domain protein; histidine kinase HAMP region domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0558"
FT                   /db_xref="EnsemblGenomes-Tr:ADH98094"
FT                   /db_xref="GOA:D6XY21"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:D6XY21"
FT                   /inference="protein motif:PFAM:PF02518"
FT                   /protein_id="ADH98094.1"
FT                   /translation="MRKKMQSIRNKVLFFGLLMTIIPLALISVYYIQNMADYVGETGEE
FT                   MQKMRLEHLATDIRSEIRQVMDQLDVLASLERPAEMKGPFYEVLSSQDAIDTLVVIDRD
FT                   GVLLSQVARHTLNHADTGDTWPVQADSGVTPDAGEPVISDVLVNEYGQPYMQMIAETGT
FT                   DGLRIGATVQLQKLIGNVSSYQLDDEAVIYLEDPSNQVIAHQDYSKLWQPSTEETAQGI
FT                   EIRTEIDEVQWELVMEQPRREALSPVFDMMRRGGFTATVMILFGSVISVFAGLYFVKPI
FT                   ETLQQGMRRMKTGYWPEAMPVERQDEFGELTRAFNEMNETIQEKEQRLRQEKERLDIVV
FT                   NSMDAGLAVVRKDYSIAWMNPKLEGWIGERREVPCFQLFHDQDDACYACPLRDEVTYDK
FT                   MDEIMTRKDRSGAERIYRHRVFPLNYTLEQDEEALIVMEDITEEKQMEEKIIQTDKLSA
FT                   LGLMASSFAHEVNNPLASVQIYAEDLSDRLTEDEAELLESGDMAHYLQVIRKNIDRCKT
FT                   ITGNLLNFSRKENWEERDIRVRQVVEESLVLMNHSLNKQGVDVTVTEEEGLPAIRGDAL
FT                   KLSQVFVNFIQNAIDAMAGKTAPALSIRLYQEGQDLLVDVADNGSGIRPEDLDKLFDPF
FT                   FTSKPTGKGTGLGLSVCYGIIKQMNGVLEVESEPGEGAVFRVRLPVPQKETNPEHGEV"
     MRKKMQSIRN KVLFFGLLMT IIPLALISVY YIQNMADYVG ETGEEMQKMR LEHLATDIRS        60
     EIRQVMDQLD VLASLERPAE MKGPFYEVLS SQDAIDTLVV IDRDGVLLSQ VARHTLNHAD       120
     TGDTWPVQAD SGVTPDAGEP VISDVLVNEY GQPYMQMIAE TGTDGLRIGA TVQLQKLIGN       180
     VSSYQLDDEA VIYLEDPSNQ VIAHQDYSKL WQPSTEETAQ GIEIRTEIDE VQWELVMEQP       240
     RREALSPVFD MMRRGGFTAT VMILFGSVIS VFAGLYFVKP IETLQQGMRR MKTGYWPEAM       300
     PVERQDEFGE LTRAFNEMNE TIQEKEQRLR QEKERLDIVV NSMDAGLAVV RKDYSIAWMN       360
     PKLEGWIGER REVPCFQLFH DQDDACYACP LRDEVTYDKM DEIMTRKDRS GAERIYRHRV       420
     FPLNYTLEQD EEALIVMEDI TEEKQMEEKI IQTDKLSALG LMASSFAHEV NNPLASVQIY       480
     AEDLSDRLTE DEAELLESGD MAHYLQVIRK NIDRCKTITG NLLNFSRKEN WEERDIRVRQ       540
     VVEESLVLMN HSLNKQGVDV TVTEEEGLPA IRGDALKLSQ VFVNFIQNAI DAMAGKTAPA       600
     LSIRLYQEGQ DLLVDVADNG SGIRPEDLDK LFDPFFTSKP TGKGTGLGLS VCYGIIKQMN       660
     GVLEVESEPG EGAVFRVRLP VPQKETNPEH GEV                                    693
//

If you have problems or comments...

PBIL Back to PBIL home page