(data stored in ACNUC7421 zone)

EMBL: CP001791.PE543

CP001791.PE543       Location/Qualifiers
FT   CDS             600629..601888
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0559"
FT                   /product="putative two component, sigma54 specific,
FT                   transcriptional regulator, Fis family"
FT                   /note="KEGG: gme:Gmet_1397 two component, sigma54 specific,
FT                   Fis family transcriptional regulator; PFAM: sigma-54 factor
FT                   interaction domain-containing protein; response regulator
FT                   receiver; SMART: response regulator receiver; AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0559"
FT                   /db_xref="EnsemblGenomes-Tr:ADH98095"
FT                   /db_xref="GOA:D6XY22"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR002078"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR025662"
FT                   /db_xref="InterPro:IPR025944"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D6XY22"
FT                   /inference="protein motif:PFAM:PF00158"
FT                   /protein_id="ADH98095.1"
FT                   /translation="MERILVADDEQDLRELLVSRLKRKGFEVFGAADGEEALALLQKER
FT                   YDLGIFDIRMEPMDGLTLLEEVKSRPDTLEMEVVMLTGHGTMETAIEAMKRGAYDYLTK
FT                   PYNLSELEVVISKALEKKKLTEDNQTMRNLMHARDNDFDIVGKSSAVEQVKHLIRRVAD
FT                   ADASILIEGESGTGKELVAKGLHYWSKRAAEPFVAVNAGAIPDQLIESELFGHVKGAFT
FT                   GAQKDKKGLVEVADQGTLFLDEIGEMPLDMQVKLLRFLETGSFRRVGETKERHVQVRTV
FT                   AATNRSLIEEAREGRFREDLFYRLQVMTIEVPPLRDRKEDIPLLADYFLSKQGKAKRLT
FT                   DTAMKQLMSYDFPGNIRELMHILERGCLLCPGAEIEGGDLMLPGTFQDPQDRDSVSPVQ
FT                   TLEEVERDSHRPGAHLYRLE"
     MERILVADDE QDLRELLVSR LKRKGFEVFG AADGEEALAL LQKERYDLGI FDIRMEPMDG        60
     LTLLEEVKSR PDTLEMEVVM LTGHGTMETA IEAMKRGAYD YLTKPYNLSE LEVVISKALE       120
     KKKLTEDNQT MRNLMHARDN DFDIVGKSSA VEQVKHLIRR VADADASILI EGESGTGKEL       180
     VAKGLHYWSK RAAEPFVAVN AGAIPDQLIE SELFGHVKGA FTGAQKDKKG LVEVADQGTL       240
     FLDEIGEMPL DMQVKLLRFL ETGSFRRVGE TKERHVQVRT VAATNRSLIE EAREGRFRED       300
     LFYRLQVMTI EVPPLRDRKE DIPLLADYFL SKQGKAKRLT DTAMKQLMSY DFPGNIRELM       360
     HILERGCLLC PGAEIEGGDL MLPGTFQDPQ DRDSVSPVQT LEEVERDSHR PGAHLYRLE        419
//

If you have problems or comments...

PBIL Back to PBIL home page