(data stored in ACNUC7421 zone)

EMBL: CP001791.PE544

CP001791.PE544       Location/Qualifiers
FT   CDS             602232..602414
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0560"
FT                   /product="twin-arginine translocation protein, TatA/E
FT                   family subunit"
FT                   /note="KEGG: dat:HRM2_06850 TatA; TIGRFAM: twin-arginine
FT                   translocation protein, TatA/E family subunit; PFAM:
FT                   sec-independent translocation protein mttA/Hcf106"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0560"
FT                   /db_xref="EnsemblGenomes-Tr:ADH98096"
FT                   /db_xref="GOA:D6XY23"
FT                   /db_xref="InterPro:IPR003369"
FT                   /db_xref="InterPro:IPR006312"
FT                   /db_xref="UniProtKB/TrEMBL:D6XY23"
FT                   /inference="protein motif:TFAM:TIGR01411"
FT                   /protein_id="ADH98096.1"
FT                   /translation="MLSNIGIPGLILILIIALIIFGPKKLPEMGRAVGDTLKEFKKSTR
FT                   ELTSDSNDDKDETKS"
     MLSNIGIPGL ILILIIALII FGPKKLPEMG RAVGDTLKEF KKSTRELTSD SNDDKDETKS        60
//

If you have problems or comments...

PBIL Back to PBIL home page