(data stored in ACNUC7421 zone)

EMBL: CP001791.PE546

CP001791.PE546       Location/Qualifiers
FT   CDS             603304..604590
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0562"
FT                   /product="Polysulphide reductase NrfD"
FT                   /note="PFAM: Polysulphide reductase NrfD; KEGG:
FT                   afw:Anae109_3085 polysulphide reductase NrfD"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0562"
FT                   /db_xref="EnsemblGenomes-Tr:ADH98098"
FT                   /db_xref="GOA:D6XY25"
FT                   /db_xref="InterPro:IPR005614"
FT                   /db_xref="UniProtKB/TrEMBL:D6XY25"
FT                   /inference="protein motif:PFAM:PF03916"
FT                   /protein_id="ADH98098.1"
FT                   /translation="MSELTQTTAEHQQDLDPGIVAKRFKLWMASLFIALIAGGGAILYR
FT                   LIEGLSVTNLTTFVPWGAWVAFYIFFVGLSAGAFLLSTLIFVFGMEQYERVGRYALFTA
FT                   LVSMVVALTFIALDLGRIDRAFNAMTYWNALSILSYEVRFYLIYMALLAVELWFAMRID
FT                   LVRVAKSDDGIKGKVANFLRLGSDDESDISKKKDHRWMKILGIIGIPIAIIGVHGGTGT
FT                   LFAAVAAQPYWNSPLFPVIFVVSALVSGTALLIAMYVIQRKASGKSVDFGMVKSLSLLM
FT                   IGFLIIDLGLEFYEFLVAGLTMKPEKMAILNVMFTGPMSWSFWGVQLFIGAVIPIFIVF
FT                   SKRFNQSIGWLTAAAIMVVIGIIGVRFNIVVPTQIVQSMKALPEAFYFPNWVEWLSSIG
FT                   VVAMGLIIYSIGAKLLPLELNEDEVKSHE"
     MSELTQTTAE HQQDLDPGIV AKRFKLWMAS LFIALIAGGG AILYRLIEGL SVTNLTTFVP        60
     WGAWVAFYIF FVGLSAGAFL LSTLIFVFGM EQYERVGRYA LFTALVSMVV ALTFIALDLG       120
     RIDRAFNAMT YWNALSILSY EVRFYLIYMA LLAVELWFAM RIDLVRVAKS DDGIKGKVAN       180
     FLRLGSDDES DISKKKDHRW MKILGIIGIP IAIIGVHGGT GTLFAAVAAQ PYWNSPLFPV       240
     IFVVSALVSG TALLIAMYVI QRKASGKSVD FGMVKSLSLL MIGFLIIDLG LEFYEFLVAG       300
     LTMKPEKMAI LNVMFTGPMS WSFWGVQLFI GAVIPIFIVF SKRFNQSIGW LTAAAIMVVI       360
     GIIGVRFNIV VPTQIVQSMK ALPEAFYFPN WVEWLSSIGV VAMGLIIYSI GAKLLPLELN       420
     EDEVKSHE                                                                428
//

If you have problems or comments...

PBIL Back to PBIL home page