(data stored in ACNUC7421 zone)

EMBL: CP001791.PE548

CP001791.PE548       Location/Qualifiers
FT   CDS             607711..608322
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0564"
FT                   /product="Uncharacterized component of anaerobic
FT                   dehydrogenase-like protein"
FT                   /note="KEGG: sfr:Sfri_3126 cytoplasmic chaperone TorD
FT                   family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0564"
FT                   /db_xref="EnsemblGenomes-Tr:ADH98100"
FT                   /db_xref="InterPro:IPR020945"
FT                   /db_xref="InterPro:IPR036411"
FT                   /db_xref="UniProtKB/TrEMBL:D6XY27"
FT                   /inference="protein motif:COG:COG3381"
FT                   /protein_id="ADH98100.1"
FT                   /translation="MQPAFETETHEQQLKLSLTYLIYARCFYGQVDVIKAMVDTGEATG
FT                   EVDEDVRHLLHQLRETPEEELTLQYENLFFIPGPYYVPPYVSVYLDDEEANGSMVHQLS
FT                   GYYARFGFLDYAKTTNLRHDHIGTVLMFAHYLIQMQLEQHEDAEDAKKMYLILLHEVIR
FT                   PMYGVFEKKVSDQLVKGFYLDLVQGAHRFLSDTSEIIEKD"
     MQPAFETETH EQQLKLSLTY LIYARCFYGQ VDVIKAMVDT GEATGEVDED VRHLLHQLRE        60
     TPEEELTLQY ENLFFIPGPY YVPPYVSVYL DDEEANGSMV HQLSGYYARF GFLDYAKTTN       120
     LRHDHIGTVL MFAHYLIQMQ LEQHEDAEDA KKMYLILLHE VIRPMYGVFE KKVSDQLVKG       180
     FYLDLVQGAH RFLSDTSEII EKD                                               203
//

If you have problems or comments...

PBIL Back to PBIL home page