(data stored in ACNUC7421 zone)

EMBL: CP001791.PE550

CP001791.PE550       Location/Qualifiers
FT   CDS             complement(608591..609325)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0566"
FT                   /product="Abortive infection protein"
FT                   /note="PFAM: Abortive infection protein; KEGG:
FT                   smt:Smal_0005 abortive infection protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0566"
FT                   /db_xref="EnsemblGenomes-Tr:ADH98102"
FT                   /db_xref="GOA:D6XY29"
FT                   /db_xref="InterPro:IPR003675"
FT                   /db_xref="UniProtKB/TrEMBL:D6XY29"
FT                   /inference="protein motif:PFAM:PF02517"
FT                   /protein_id="ADH98102.1"
FT                   /translation="MNKYYWLIILSFVFSQLAPALIAPLLLNMGFDGNETELFATAIAY
FT                   SMTIGFILAVLFSALAGRDPQFDGKRADTGKTILWSFIGIFLAFAGQYAASLIQMLAFG
FT                   IEPGSENTEMIVGFSTAVPFMIFVVAILVPVTEELVFRKVIFGAIYKRTGFWIAAIVSG
FT                   LIFGALHGDFENILVYLAMGVVFSYLYVKTGRIIVPIIAHVGINSFVMLVQVVFGDRLL
FT                   ELIDQLEEMEQSIQALMGVFLS"
     MNKYYWLIIL SFVFSQLAPA LIAPLLLNMG FDGNETELFA TAIAYSMTIG FILAVLFSAL        60
     AGRDPQFDGK RADTGKTILW SFIGIFLAFA GQYAASLIQM LAFGIEPGSE NTEMIVGFST       120
     AVPFMIFVVA ILVPVTEELV FRKVIFGAIY KRTGFWIAAI VSGLIFGALH GDFENILVYL       180
     AMGVVFSYLY VKTGRIIVPI IAHVGINSFV MLVQVVFGDR LLELIDQLEE MEQSIQALMG       240
     VFLS                                                                    244
//

If you have problems or comments...

PBIL Back to PBIL home page