(data stored in ACNUC7421 zone)

EMBL: CP001791.PE553

CP001791.PE553       Location/Qualifiers
FT   CDS             complement(611692..613524)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0569"
FT                   /product="7TM domain sensor diguanylate cyclase"
FT                   /note="TIGRFAM: diguanylate cyclase; PFAM: GGDEF domain
FT                   containing protein; Diverse 7TM receptor transmembrane
FT                   region; KEGG: glo:Glov_2918 integral membrane sensor signal
FT                   transduction histidine kinase; SMART: GGDEF domain
FT                   containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0569"
FT                   /db_xref="EnsemblGenomes-Tr:ADH98105"
FT                   /db_xref="GOA:D6XY32"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR008979"
FT                   /db_xref="InterPro:IPR011623"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="UniProtKB/TrEMBL:D6XY32"
FT                   /inference="protein motif:TFAM:TIGR00254"
FT                   /protein_id="ADH98105.1"
FT                   /translation="MNKITVYIKPMTLFVSFVLLIGFTIYLIIVSEYDHYPAATNGELD
FT                   TSFWDTEDGSIPLSGEWHFYWSSLLEPDERSGEEPVVIDVPRSWNGTLVNGETIGGKGY
FT                   ATYHVQVTAPEADDLALYMPYLLTAYRLWINGESVASNGEVGTSAETMTPRYFADVVPL
FT                   ASSRDQIDIHIQVSNFMHAEGGMNIPLRLGTHDTISSETDNRRLIDGIIFGSLLIMSIY
FT                   HFLVFLLRPRFRSALYFSLFCLMIGIRSLLVGEAVMLRVFPDFNWTFAMKLEYVTTYLS
FT                   PPLFILFLSALFPNETSRLFRRVSVTIGLILGSIVILFPVYWFTQTLIVGQVVTVITVG
FT                   YICYILILAALRKRMGATVSLFMAFLYAITIVNDILYDYQLSIYGNLSPAGLLFFILAQ
FT                   SFMLASIFSKAFTDLEDMSERLIASNEILESKVEERTKKLKDLSVRDPLTNVYNRGGFD
FT                   QQMKAKWTEALQERKELSLLFVDIDYFKRYNDEYGHQAGDQTLISVAHTLQEALGEKAI
FT                   VSRYGGEEFVLILPGASEEQAASAAATLLKAIRDQQIPHSQSQVAPYVTVSIGGISRIP
FT                   NETDKPDAFIKQADQALYAAKEAGRDRYILAQDV"
     MNKITVYIKP MTLFVSFVLL IGFTIYLIIV SEYDHYPAAT NGELDTSFWD TEDGSIPLSG        60
     EWHFYWSSLL EPDERSGEEP VVIDVPRSWN GTLVNGETIG GKGYATYHVQ VTAPEADDLA       120
     LYMPYLLTAY RLWINGESVA SNGEVGTSAE TMTPRYFADV VPLASSRDQI DIHIQVSNFM       180
     HAEGGMNIPL RLGTHDTISS ETDNRRLIDG IIFGSLLIMS IYHFLVFLLR PRFRSALYFS       240
     LFCLMIGIRS LLVGEAVMLR VFPDFNWTFA MKLEYVTTYL SPPLFILFLS ALFPNETSRL       300
     FRRVSVTIGL ILGSIVILFP VYWFTQTLIV GQVVTVITVG YICYILILAA LRKRMGATVS       360
     LFMAFLYAIT IVNDILYDYQ LSIYGNLSPA GLLFFILAQS FMLASIFSKA FTDLEDMSER       420
     LIASNEILES KVEERTKKLK DLSVRDPLTN VYNRGGFDQQ MKAKWTEALQ ERKELSLLFV       480
     DIDYFKRYND EYGHQAGDQT LISVAHTLQE ALGEKAIVSR YGGEEFVLIL PGASEEQAAS       540
     AAATLLKAIR DQQIPHSQSQ VAPYVTVSIG GISRIPNETD KPDAFIKQAD QALYAAKEAG       600
     RDRYILAQDV                                                              610
//

If you have problems or comments...

PBIL Back to PBIL home page