(data stored in ACNUC7421 zone)

EMBL: CP001791.PE554

CP001791.PE554       Location/Qualifiers
FT   CDS             complement(613690..614721)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0570"
FT                   /product="dihydrouridine synthase DuS"
FT                   /note="PFAM: dihydrouridine synthase DuS; KEGG:
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0570"
FT                   /db_xref="EnsemblGenomes-Tr:ADH98106"
FT                   /db_xref="GOA:D6XY33"
FT                   /db_xref="InterPro:IPR001269"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR018517"
FT                   /db_xref="InterPro:IPR035587"
FT                   /db_xref="UniProtKB/TrEMBL:D6XY33"
FT                   /inference="protein motif:PFAM:PF01207"
FT                   /protein_id="ADH98106.1"
FT                   /translation="MKENFWHDLPKPFFILAPMEAVTDVVFRHVVSEAAAPDVFFTEFA
FT                   NSDSFCHPKGRESLKGRLMFTEDEQPIVAHIWGDKPEHFRTMSVAMAEMGYKGIDINMG
FT                   CPVHNVAGDGKGAGLIKRPDVAAELIEAAKAGGLPVSVKTRIGFSKIDEWQNWLRHILE
FT                   QDIVNLSIHLRTKKEMSDVPAHWELIPDIKALRDEVAPNTLLTINGDIDDRQTGLELAE
FT                   KYGVDGIMIGRGIFKNPFAFETEPKEHTSEELLGLLRLQLDLHDKYSKDLENRPFTPLQ
FT                   RFFKIYVRSFPKAGELRKKLMETKTTDEVRAILDTFEKEKQAEEKAEAEALCQTASTDH
FT                   VHS"
     MKENFWHDLP KPFFILAPME AVTDVVFRHV VSEAAAPDVF FTEFANSDSF CHPKGRESLK        60
     GRLMFTEDEQ PIVAHIWGDK PEHFRTMSVA MAEMGYKGID INMGCPVHNV AGDGKGAGLI       120
     KRPDVAAELI EAAKAGGLPV SVKTRIGFSK IDEWQNWLRH ILEQDIVNLS IHLRTKKEMS       180
     DVPAHWELIP DIKALRDEVA PNTLLTINGD IDDRQTGLEL AEKYGVDGIM IGRGIFKNPF       240
     AFETEPKEHT SEELLGLLRL QLDLHDKYSK DLENRPFTPL QRFFKIYVRS FPKAGELRKK       300
     LMETKTTDEV RAILDTFEKE KQAEEKAEAE ALCQTASTDH VHS                         343
//

If you have problems or comments...

PBIL Back to PBIL home page