(data stored in ACNUC7421 zone)

EMBL: CP001791.PE555

CP001791.PE555       Location/Qualifiers
FT   CDS             complement(614874..615761)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0571"
FT                   /product="fumarylacetoacetate (FAA) hydrolase"
FT                   /note="PFAM: fumarylacetoacetate (FAA) hydrolase; KEGG:
FT                   pna:Pnap_0618 5-carboxymethyl-2-hydroxymuconate
FT                   delta-isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0571"
FT                   /db_xref="EnsemblGenomes-Tr:ADH98107"
FT                   /db_xref="GOA:D6XY34"
FT                   /db_xref="InterPro:IPR011234"
FT                   /db_xref="InterPro:IPR036663"
FT                   /db_xref="UniProtKB/TrEMBL:D6XY34"
FT                   /inference="protein motif:PFAM:PF01557"
FT                   /protein_id="ADH98107.1"
FT                   /translation="MEIMTIRHNNRQESAIITANRVYPLQAINECCMTDWPLTIDRILK
FT                   EERMTELTRWYADQTARIWEGIPSEDLEHIETGSLFESPATIWGIGFNYQPTGEPMPAE
FT                   RANHPVSFVKPWNTVTPVNGPILVPNGSESTTGEGEIACIIGKPGKNLTVQEARHCIAG
FT                   YTAALDMTESGIHKEHPRFLARAKSFDTFCAIGPTLTSADSFYTEDITVQTILNGEVSA
FT                   ENHTGRMLMNIPEIVAYFSQGTTLNPGDIILTGTPGPVKIRPGDTLAVHVDGLRPPDQI
FT                   GFRRMIRYNVMAIS"
     MEIMTIRHNN RQESAIITAN RVYPLQAINE CCMTDWPLTI DRILKEERMT ELTRWYADQT        60
     ARIWEGIPSE DLEHIETGSL FESPATIWGI GFNYQPTGEP MPAERANHPV SFVKPWNTVT       120
     PVNGPILVPN GSESTTGEGE IACIIGKPGK NLTVQEARHC IAGYTAALDM TESGIHKEHP       180
     RFLARAKSFD TFCAIGPTLT SADSFYTEDI TVQTILNGEV SAENHTGRML MNIPEIVAYF       240
     SQGTTLNPGD IILTGTPGPV KIRPGDTLAV HVDGLRPPDQ IGFRRMIRYN VMAIS            295
//

If you have problems or comments...

PBIL Back to PBIL home page