(data stored in ACNUC7421 zone)

EMBL: CP001791.PE559

CP001791.PE559       Location/Qualifiers
FT   CDS             620529..621377
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0575"
FT                   /product="molybdopterin dehydrogenase FAD-binding protein"
FT                   /note="PFAM: molybdopterin dehydrogenase FAD-binding; KEGG:
FT                   avi:Avi_5433 dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0575"
FT                   /db_xref="EnsemblGenomes-Tr:ADH98111"
FT                   /db_xref="GOA:D6XY38"
FT                   /db_xref="InterPro:IPR002346"
FT                   /db_xref="InterPro:IPR005107"
FT                   /db_xref="InterPro:IPR016166"
FT                   /db_xref="InterPro:IPR016169"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="InterPro:IPR036683"
FT                   /db_xref="UniProtKB/TrEMBL:D6XY38"
FT                   /inference="protein motif:PFAM:PF00941"
FT                   /protein_id="ADH98111.1"
FT                   /translation="MDQLYIHTPDTLSEAWALKTKDPTDSLWLSGTTWLRTQWEAGQLK
FT                   TQKQWIRLDGIPELTSGIRRDESTLRIAALTTFGEISRCGDTAAFAPLLKQAIHEIAAP
FT                   SIREQATIGGNVATGSGDSIPALLASGASVLVYTEGRDEEWLLEDWLAAGMSGIIVDIA
FT                   IPVHKESEDLNVYVKTGRREAFIPSAATFAIKGSWDSDTKTFRTCRAAAGGGTMVPVRL
FT                   KRLERFLKETPLTSNAVFKKMADEVKKDYRPEDDPFLSGAYKQQIVCNQIIQNIHSNIR
FT                   R"
     MDQLYIHTPD TLSEAWALKT KDPTDSLWLS GTTWLRTQWE AGQLKTQKQW IRLDGIPELT        60
     SGIRRDESTL RIAALTTFGE ISRCGDTAAF APLLKQAIHE IAAPSIREQA TIGGNVATGS       120
     GDSIPALLAS GASVLVYTEG RDEEWLLEDW LAAGMSGIIV DIAIPVHKES EDLNVYVKTG       180
     RREAFIPSAA TFAIKGSWDS DTKTFRTCRA AAGGGTMVPV RLKRLERFLK ETPLTSNAVF       240
     KKMADEVKKD YRPEDDPFLS GAYKQQIVCN QIIQNIHSNI RR                          282
//

If you have problems or comments...

PBIL Back to PBIL home page