(data stored in ACNUC7421 zone)

EMBL: CP001791.PE565

CP001791.PE565       Location/Qualifiers
FT   CDS             627372..627899
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0581"
FT                   /product="OHCU decarboxylase"
FT                   /note="KEGG: sme:SM_b20874 hypothetical protein; TIGRFAM:
FT                   OHCU decarboxylase; PFAM:
FT                   Oxo-4-hydroxy-4-carboxy-5-ureidoimidazoline decarboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0581"
FT                   /db_xref="EnsemblGenomes-Tr:ADH98117"
FT                   /db_xref="GOA:D6XY44"
FT                   /db_xref="InterPro:IPR017580"
FT                   /db_xref="InterPro:IPR018020"
FT                   /db_xref="InterPro:IPR036778"
FT                   /db_xref="UniProtKB/TrEMBL:D6XY44"
FT                   /inference="protein motif:TFAM:TIGR03164"
FT                   /protein_id="ADH98117.1"
FT                   /translation="MQMTELHRLSREAFVAQIGHVFEHSPWVADSAYEQAGPFHTSEEV
FT                   YKQLLTAMHEGTEDQKLSLLRAHPDLGGRIQMTDASVAEQKGAGLNQLSEKEYETLKRL
FT                   NTHYTERFGFPFILAVKGKTKEDIISNIESRIENSREEEFETALNEVGKIAVFRLNDLL
FT                   GGEHEKEELNHV"
     MQMTELHRLS REAFVAQIGH VFEHSPWVAD SAYEQAGPFH TSEEVYKQLL TAMHEGTEDQ        60
     KLSLLRAHPD LGGRIQMTDA SVAEQKGAGL NQLSEKEYET LKRLNTHYTE RFGFPFILAV       120
     KGKTKEDIIS NIESRIENSR EEEFETALNE VGKIAVFRLN DLLGGEHEKE ELNHV            175
//

If you have problems or comments...

PBIL Back to PBIL home page