(data stored in ACNUC7421 zone)

EMBL: CP001791.PE567

CP001791.PE567       Location/Qualifiers
FT   CDS             628848..629186
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0583"
FT                   /product="hydroxyisourate hydrolase"
FT                   /note="KEGG: reh:H16_A1009 transthyretin-like protein;
FT                   TIGRFAM: hydroxyisourate hydrolase; PFAM: Transthyretin"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0583"
FT                   /db_xref="EnsemblGenomes-Tr:ADH98119"
FT                   /db_xref="GOA:D6XY46"
FT                   /db_xref="InterPro:IPR000895"
FT                   /db_xref="InterPro:IPR014306"
FT                   /db_xref="InterPro:IPR023416"
FT                   /db_xref="InterPro:IPR023419"
FT                   /db_xref="InterPro:IPR036817"
FT                   /db_xref="UniProtKB/TrEMBL:D6XY46"
FT                   /inference="protein motif:TFAM:TIGR02962"
FT                   /protein_id="ADH98119.1"
FT                   /translation="MGRLTTHVLNTATGLPAVGMKLILRKGNEEGGYTMLSDTVTNHDG
FT                   RVDAPLLEGDAFTSGVYELTFFVGDYFQTEDAFLDEVPIRFTVDDATRHYHVPLLVTPY
FT                   SYTTYRGS"
     MGRLTTHVLN TATGLPAVGM KLILRKGNEE GGYTMLSDTV TNHDGRVDAP LLEGDAFTSG        60
     VYELTFFVGD YFQTEDAFLD EVPIRFTVDD ATRHYHVPLL VTPYSYTTYR GS               112
//

If you have problems or comments...

PBIL Back to PBIL home page