(data stored in ACNUC7421 zone)

EMBL: CP001791.PE568

CP001791.PE568       Location/Qualifiers
FT   CDS             629212..630471
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0584"
FT                   /product="amidase, hydantoinase/carbamoylase family"
FT                   /EC_number="3.5.1.87"
FT                   /note="TIGRFAM: amidase, hydantoinase/carbamoylase family;
FT                   KEGG: mes:Meso_2546 allantoate amidohydrolase; PFAM:
FT                   peptidase M20; peptidase dimerisation domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0584"
FT                   /db_xref="EnsemblGenomes-Tr:ADH98120"
FT                   /db_xref="GOA:D6XY47"
FT                   /db_xref="InterPro:IPR002933"
FT                   /db_xref="InterPro:IPR010158"
FT                   /db_xref="InterPro:IPR036264"
FT                   /db_xref="UniProtKB/TrEMBL:D6XY47"
FT                   /inference="protein motif:TFAM:TIGR01879"
FT                   /protein_id="ADH98120.1"
FT                   /translation="MQTMTGIDQLRLWRTLMDLRQIGAGATEADGITRLAFSPPELEAK
FT                   AYIRVLMEECGLDVYTDAVGNVFGVYQGREPDLPVIMTGSHVDSVIRGGAFDGTLGVLG
FT                   AIEAVRTMKEAGIRPRRTIEIVSFSDEEGTRFGAGYMGSKALAGKLDDRFLTLTDQEGE
FT                   SYETVLTKAGYEPSAYPKAKRDSREIGAFLEMHIEQGRVLEEADIAAGIVTTIQGPLWL
FT                   QVTIEGAADHAGATPMAIRKDASLAMAEAMLAVEEAAVTHGGVGTVGSLKVKPGGINII
FT                   PGEVVFTVDMRHGDTTLRDRMLTDIEASFSAIAGKRGVSFKTLVTKKEPPATCSEDIRA
FT                   SIHQAANTCGIPVKDMPCGAGHDALIMSTVTRMGMILVRSQDGISHNPQEWTSQEDCAK
FT                   GTELLMRTLHSLAEERGDEA"
     MQTMTGIDQL RLWRTLMDLR QIGAGATEAD GITRLAFSPP ELEAKAYIRV LMEECGLDVY        60
     TDAVGNVFGV YQGREPDLPV IMTGSHVDSV IRGGAFDGTL GVLGAIEAVR TMKEAGIRPR       120
     RTIEIVSFSD EEGTRFGAGY MGSKALAGKL DDRFLTLTDQ EGESYETVLT KAGYEPSAYP       180
     KAKRDSREIG AFLEMHIEQG RVLEEADIAA GIVTTIQGPL WLQVTIEGAA DHAGATPMAI       240
     RKDASLAMAE AMLAVEEAAV THGGVGTVGS LKVKPGGINI IPGEVVFTVD MRHGDTTLRD       300
     RMLTDIEASF SAIAGKRGVS FKTLVTKKEP PATCSEDIRA SIHQAANTCG IPVKDMPCGA       360
     GHDALIMSTV TRMGMILVRS QDGISHNPQE WTSQEDCAKG TELLMRTLHS LAEERGDEA        419
//

If you have problems or comments...

PBIL Back to PBIL home page