(data stored in ACNUC7421 zone)

EMBL: CP001791.PE569

CP001791.PE569       Location/Qualifiers
FT   CDS             630468..631724
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0585"
FT                   /product="aminotransferase class V"
FT                   /note="PFAM: aminotransferase class V; KEGG: dda:Dd703_0911
FT                   aminotransferase class V"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0585"
FT                   /db_xref="EnsemblGenomes-Tr:ADH98121"
FT                   /db_xref="GOA:D6XY48"
FT                   /db_xref="InterPro:IPR000192"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR024169"
FT                   /db_xref="UniProtKB/TrEMBL:D6XY48"
FT                   /inference="protein motif:PFAM:PF00266"
FT                   /protein_id="ADH98121.1"
FT                   /translation="MIRQKPLHVAPRTIMTPGPVEAEPSVLKAMSSTVLGQFDPDFTSV
FT                   MNEVMVMLRDVLQTGNHWAYPVDGTSRAGIEAMLGSVIEEGDRVLIPAFGRFGFLLKEI
FT                   CERVGGDVKMLTCEWGEVFEPSEIIGEIQAWQPKVVAMVHGDTSTGRVHPLKEIGEACR
FT                   SNDALFIVDAVATVAGMDVRPDEWCIDGLITGTQKCLSIPSGLAPLTYNDRIEAVIQER
FT                   KSVEAGIAAAGDPSGHDRRIRSNYLDLSQLQDYWSPKRLNHHTEATAMIYGLHEGLRVI
FT                   LEETLEARFERHRLNEQALTAGIRAMGLELFGDPDAKLTTVTCIRIPEGTDGEAVRRQL
FT                   LDDYGIEIASSFGPLHGKIWRIGTMGYSCQKRNVLITLNALESVLTHQGCKVHKGTAAQ
FT                   AALEVYHQKKAPEITGIPG"
     MIRQKPLHVA PRTIMTPGPV EAEPSVLKAM SSTVLGQFDP DFTSVMNEVM VMLRDVLQTG        60
     NHWAYPVDGT SRAGIEAMLG SVIEEGDRVL IPAFGRFGFL LKEICERVGG DVKMLTCEWG       120
     EVFEPSEIIG EIQAWQPKVV AMVHGDTSTG RVHPLKEIGE ACRSNDALFI VDAVATVAGM       180
     DVRPDEWCID GLITGTQKCL SIPSGLAPLT YNDRIEAVIQ ERKSVEAGIA AAGDPSGHDR       240
     RIRSNYLDLS QLQDYWSPKR LNHHTEATAM IYGLHEGLRV ILEETLEARF ERHRLNEQAL       300
     TAGIRAMGLE LFGDPDAKLT TVTCIRIPEG TDGEAVRRQL LDDYGIEIAS SFGPLHGKIW       360
     RIGTMGYSCQ KRNVLITLNA LESVLTHQGC KVHKGTAAQA ALEVYHQKKA PEITGIPG         418
//

If you have problems or comments...

PBIL Back to PBIL home page