(data stored in ACNUC7421 zone)

EMBL: CP001791.PE57

CP001791.PE57        Location/Qualifiers
FT   CDS             69779..71236
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0058"
FT                   /product="MazG family protein"
FT                   /note="KEGG: geo:Geob_1879 MazG family protein; TIGRFAM:
FT                   MazG family protein; PFAM: MazG nucleotide
FT                   pyrophosphohydrolase; Uroporphyrin-III C/tetrapyrrole
FT                   (Corrin/Porphyrin) methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0058"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97609"
FT                   /db_xref="GOA:D6XV51"
FT                   /db_xref="InterPro:IPR000878"
FT                   /db_xref="InterPro:IPR004518"
FT                   /db_xref="InterPro:IPR011551"
FT                   /db_xref="InterPro:IPR014777"
FT                   /db_xref="InterPro:IPR024180"
FT                   /db_xref="InterPro:IPR035013"
FT                   /db_xref="InterPro:IPR035996"
FT                   /db_xref="UniProtKB/TrEMBL:D6XV51"
FT                   /inference="protein motif:TFAM:TIGR00444"
FT                   /protein_id="ADH97609.1"
FT                   /translation="MGTIRILGLGAGDLDQLSLGVYREIRQAEQLFVRTARHPLIAALE
FT                   DEGVSFESFDTIYETESAFSDVYARIAGALLEKAEATEATIFYAVPGHPLVAEETVQRL
FT                   LRQEQVPVSIAGGGSFLDAMFTTLNIDPIEGFQLLDGLSMEPSDLMLKGHTVIGQVYDS
FT                   LSASEVKLKLMERLPDDFDVTIVDAAGTDRESVTVVPLYELDRSVTTSNLTAVYVPPAE
FT                   EEAIHYRTFDTLRGVIRTLRGPDGCPWDREQTHESLKRYMIEEAYELLEAIDEEDDDHI
FT                   ADELGDVLLQVMLHAQIGEDNGYFSIDDVIGNLSEKMVRRHPHVFSDTSVSGADQVVTN
FT                   WEAIKAEEKGHEDRHSMLDGIPKGLPGLMTAAKLQKKAGKVGFDWGEEGPMWEKLFEEI
FT                   HEWAQEVHTGTPDRSMKEFGDVLFAFVNIARFHQIDPEEALRQTNEKFRRRFQHVESRV
FT                   EESGLDWSAFSLEALDRWWEEAKDKGL"
     MGTIRILGLG AGDLDQLSLG VYREIRQAEQ LFVRTARHPL IAALEDEGVS FESFDTIYET        60
     ESAFSDVYAR IAGALLEKAE ATEATIFYAV PGHPLVAEET VQRLLRQEQV PVSIAGGGSF       120
     LDAMFTTLNI DPIEGFQLLD GLSMEPSDLM LKGHTVIGQV YDSLSASEVK LKLMERLPDD       180
     FDVTIVDAAG TDRESVTVVP LYELDRSVTT SNLTAVYVPP AEEEAIHYRT FDTLRGVIRT       240
     LRGPDGCPWD REQTHESLKR YMIEEAYELL EAIDEEDDDH IADELGDVLL QVMLHAQIGE       300
     DNGYFSIDDV IGNLSEKMVR RHPHVFSDTS VSGADQVVTN WEAIKAEEKG HEDRHSMLDG       360
     IPKGLPGLMT AAKLQKKAGK VGFDWGEEGP MWEKLFEEIH EWAQEVHTGT PDRSMKEFGD       420
     VLFAFVNIAR FHQIDPEEAL RQTNEKFRRR FQHVESRVEE SGLDWSAFSL EALDRWWEEA       480
     KDKGL                                                                   485
//

If you have problems or comments...

PBIL Back to PBIL home page