(data stored in ACNUC7421 zone)

EMBL: CP001791.PE570

CP001791.PE570       Location/Qualifiers
FT   CDS             complement(631791..632234)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0586"
FT                   /product="Ferritin Dps family protein"
FT                   /note="PFAM: Ferritin Dps family protein; KEGG:
FT                   dda:Dd703_1214 ferritin Dps family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0586"
FT                   /db_xref="EnsemblGenomes-Tr:ADH98122"
FT                   /db_xref="GOA:D6XY49"
FT                   /db_xref="InterPro:IPR002177"
FT                   /db_xref="InterPro:IPR008331"
FT                   /db_xref="InterPro:IPR009078"
FT                   /db_xref="InterPro:IPR012347"
FT                   /db_xref="UniProtKB/TrEMBL:D6XY49"
FT                   /inference="protein motif:PFAM:PF00210"
FT                   /protein_id="ADH98122.1"
FT                   /translation="MAHVKTEEILNRHVSNWSVLFVKLHNYHWYVGSTQFFTLHQKFEE
FT                   LYNEAATNIDELAERLLAAQGNPVASMSEYLKTATVKEAEGETTYEAMLDTLIGDFDLI
FT                   SKELNADIATLEDEVGDDVTADMLIGIRQSVEKHNWMLRQYTR"
     MAHVKTEEIL NRHVSNWSVL FVKLHNYHWY VGSTQFFTLH QKFEELYNEA ATNIDELAER        60
     LLAAQGNPVA SMSEYLKTAT VKEAEGETTY EAMLDTLIGD FDLISKELNA DIATLEDEVG       120
     DDVTADMLIG IRQSVEKHNW MLRQYTR                                           147
//

If you have problems or comments...

PBIL Back to PBIL home page