(data stored in ACNUC7421 zone)

EMBL: CP001791.PE574

CP001791.PE574       Location/Qualifiers
FT   CDS             complement(634407..635162)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0590"
FT                   /product="Methyltransferase type 12"
FT                   /note="PFAM: Methyltransferase type 12; Methyltransferase
FT                   type 11; KEGG: pmr:PMI0809 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0590"
FT                   /db_xref="EnsemblGenomes-Tr:ADH98126"
FT                   /db_xref="GOA:D6XY53"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR041698"
FT                   /db_xref="UniProtKB/TrEMBL:D6XY53"
FT                   /inference="protein motif:PFAM:PF08242"
FT                   /protein_id="ADH98126.1"
FT                   /translation="MTTFYNTLSSAVYNYDKAIGISFGDVGFYTSRLEGISGKILEPAV
FT                   GNGRLLIPLTEAGLTVDGFDLSEAMLSHCRQNCHDRGLSPHLWQDSMTTFTSNEQYEAI
FT                   ILPAGSFLLLPSHADGMEALRRFHDHLVPGGRLLIDLFLPDELNAGQESFRRFPLNNRE
FT                   TITLTSTVRSVDVVRQSVESYNRYEKWVDGKLTETELERFPVRWIGIEEAKLMLKEAGF
FT                   TDIRLSADYQMDKQPEQAGEMLTFEAVAK"
     MTTFYNTLSS AVYNYDKAIG ISFGDVGFYT SRLEGISGKI LEPAVGNGRL LIPLTEAGLT        60
     VDGFDLSEAM LSHCRQNCHD RGLSPHLWQD SMTTFTSNEQ YEAIILPAGS FLLLPSHADG       120
     MEALRRFHDH LVPGGRLLID LFLPDELNAG QESFRRFPLN NRETITLTST VRSVDVVRQS       180
     VESYNRYEKW VDGKLTETEL ERFPVRWIGI EEAKLMLKEA GFTDIRLSAD YQMDKQPEQA       240
     GEMLTFEAVA K                                                            251
//

If you have problems or comments...

PBIL Back to PBIL home page