(data stored in ACNUC7421 zone)

EMBL: CP001791.PE575

CP001791.PE575       Location/Qualifiers
FT   CDS             635279..635710
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0591"
FT                   /product="GCN5-related N-acetyltransferase"
FT                   /note="PFAM: GCN5-related N-acetyltransferase; KEGG:
FT                   tdn:Suden_1505 GCN5-related N-acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0591"
FT                   /db_xref="EnsemblGenomes-Tr:ADH98127"
FT                   /db_xref="GOA:D6XY54"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:D6XY54"
FT                   /inference="protein motif:PFAM:PF00583"
FT                   /protein_id="ADH98127.1"
FT                   /translation="MEDIFIVELTEEDAVSAYPVVKQLRDHLDEESYLELVKEAMANEG
FT                   YRMFGLVNGDLLVSVIGLMPMTTLYDGRAIWVSDLVTAEMQRSKGYGGILLEFAEEWAR
FT                   DHGYGKITLSSGLQREDAHRFYEEKMNYSKKSYVFKKTF"
     MEDIFIVELT EEDAVSAYPV VKQLRDHLDE ESYLELVKEA MANEGYRMFG LVNGDLLVSV        60
     IGLMPMTTLY DGRAIWVSDL VTAEMQRSKG YGGILLEFAE EWARDHGYGK ITLSSGLQRE       120
     DAHRFYEEKM NYSKKSYVFK KTF                                               143
//

If you have problems or comments...

PBIL Back to PBIL home page