(data stored in ACNUC7421 zone)

EMBL: CP001791.PE576

CP001791.PE576       Location/Qualifiers
FT   CDS             complement(635766..636116)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0592"
FT                   /product="DoxX family protein"
FT                   /note="PFAM: DoxX family protein; KEGG: pca:Pcar_1345
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0592"
FT                   /db_xref="EnsemblGenomes-Tr:ADH98128"
FT                   /db_xref="GOA:D6XY55"
FT                   /db_xref="InterPro:IPR032808"
FT                   /db_xref="UniProtKB/TrEMBL:D6XY55"
FT                   /inference="protein motif:PFAM:PF07681"
FT                   /protein_id="ADH98128.1"
FT                   /translation="MIASVLDAVVILVSVSFIIYGITCIGSVRMKQEFERFQLPGFAPW
FT                   IGILEITAGAAMLVGLAVPWLLLLASGGLTLLMAVAVFVRIRVGDTLWQSSPAVVFFLL
FT                   TAWLFFMTLQAL"
     MIASVLDAVV ILVSVSFIIY GITCIGSVRM KQEFERFQLP GFAPWIGILE ITAGAAMLVG        60
     LAVPWLLLLA SGGLTLLMAV AVFVRIRVGD TLWQSSPAVV FFLLTAWLFF MTLQAL           116
//

If you have problems or comments...

PBIL Back to PBIL home page