(data stored in ACNUC7421 zone)

EMBL: CP001791.PE577

CP001791.PE577       Location/Qualifiers
FT   CDS             complement(636113..636460)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0593"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pca:Pcar_1345 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0593"
FT                   /db_xref="EnsemblGenomes-Tr:ADH98129"
FT                   /db_xref="GOA:D6XY56"
FT                   /db_xref="InterPro:IPR032808"
FT                   /db_xref="UniProtKB/TrEMBL:D6XY56"
FT                   /inference="similar to AA sequence:KEGG:Pcar_1345"
FT                   /protein_id="ADH98129.1"
FT                   /translation="METLAIISQIIIAISIVIVWVFRFDNIVKEFKQYELSDLTRNMVG
FT                   AAKISLATLLVAGIWTSEFIVIPALIMAFLMVCAQLAHFKVKNPWSKHVPSLILLLLSL
FT                   FVAGVHSGLIG"
     METLAIISQI IIAISIVIVW VFRFDNIVKE FKQYELSDLT RNMVGAAKIS LATLLVAGIW        60
     TSEFIVIPAL IMAFLMVCAQ LAHFKVKNPW SKHVPSLILL LLSLFVAGVH SGLIG            115
//

If you have problems or comments...

PBIL Back to PBIL home page