(data stored in ACNUC7421 zone)

EMBL: CP001791.PE580

CP001791.PE580       Location/Qualifiers
FT   CDS             638636..640072
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0596"
FT                   /product="cryptochrome, DASH family"
FT                   /EC_number="4.1.99.3"
FT                   /note="TIGRFAM: cryptochrome, DASH family; KEGG: cry-dash;
FT                   cryptochrome DASH; PFAM: DNA photolyase FAD-binding; DNA
FT                   photolyase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0596"
FT                   /db_xref="EnsemblGenomes-Tr:ADH98132"
FT                   /db_xref="GOA:D6XY59"
FT                   /db_xref="InterPro:IPR002081"
FT                   /db_xref="InterPro:IPR005101"
FT                   /db_xref="InterPro:IPR006050"
FT                   /db_xref="InterPro:IPR014133"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR018394"
FT                   /db_xref="InterPro:IPR036134"
FT                   /db_xref="InterPro:IPR036155"
FT                   /db_xref="UniProtKB/TrEMBL:D6XY59"
FT                   /inference="protein motif:TFAM:TIGR02765"
FT                   /protein_id="ADH98132.1"
FT                   /translation="MRMVNVIWFRHDLRIHDHEPLRLAHWAKEETEAVFVRDARMDEKV
FT                   TPGLKRAGEHRERFLMESLVVLAGSLEAEGMPFTVLKGPVVKTMIDWLTERGATDVFLH
FT                   EHPGFEERRDLEEVQRALPHIHWHVSEGHTMFRRDQLPFSFSEFPMSFTMFRKRLEAHL
FT                   RLPEKKRSFSYDSYDTVTEAEPVFLSGKESGSFGAVRGSGDHIPHAGGQGIVRGGEQEA
FT                   LARLRSYVGNASRLFTYKETRDGMFAFDDSSKLSFWLANGSLSPKRVYRAILDMEAANG
FT                   RNESSYWLFFELLWREYFQWLMLATDARLFTKQGLLDVAIVWHEDKALFQAWKDGETGF
FT                   PLVDAAMRELKATGYMSNRARQNAASFLTKNLGINWLWGARYFEEQLIDYDPASNYGNW
FT                   AYQAGVGTDLRELRAFNVIGQGIRYDPKGSYAKNWLHLPDTLPGHTVYDPVKLSAHTDW
FT                   PQPIVDLEESLERRKQELGL"
     MRMVNVIWFR HDLRIHDHEP LRLAHWAKEE TEAVFVRDAR MDEKVTPGLK RAGEHRERFL        60
     MESLVVLAGS LEAEGMPFTV LKGPVVKTMI DWLTERGATD VFLHEHPGFE ERRDLEEVQR       120
     ALPHIHWHVS EGHTMFRRDQ LPFSFSEFPM SFTMFRKRLE AHLRLPEKKR SFSYDSYDTV       180
     TEAEPVFLSG KESGSFGAVR GSGDHIPHAG GQGIVRGGEQ EALARLRSYV GNASRLFTYK       240
     ETRDGMFAFD DSSKLSFWLA NGSLSPKRVY RAILDMEAAN GRNESSYWLF FELLWREYFQ       300
     WLMLATDARL FTKQGLLDVA IVWHEDKALF QAWKDGETGF PLVDAAMREL KATGYMSNRA       360
     RQNAASFLTK NLGINWLWGA RYFEEQLIDY DPASNYGNWA YQAGVGTDLR ELRAFNVIGQ       420
     GIRYDPKGSY AKNWLHLPDT LPGHTVYDPV KLSAHTDWPQ PIVDLEESLE RRKQELGL         478
//

If you have problems or comments...

PBIL Back to PBIL home page