(data stored in ACNUC7421 zone)

EMBL: CP001791.PE62

CP001791.PE62        Location/Qualifiers
FT   CDS             73447..73899
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0063"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: abu:Abu_0318 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0063"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97614"
FT                   /db_xref="GOA:D6XV56"
FT                   /db_xref="InterPro:IPR024528"
FT                   /db_xref="UniProtKB/TrEMBL:D6XV56"
FT                   /inference="similar to AA sequence:KEGG:Abu_0318"
FT                   /protein_id="ADH97614.1"
FT                   /translation="MVTFILQLIITFAATVAFGILFNVPKRALLIGGAIGVCTWAVLSI
FT                   SMMLGAAQVVSTGLASISAAVNAHFLARKLKLPVTTLSIPGILPLVPGSRAYFTMLAFV
FT                   DGDYLQGLEYGVETMLIAGAIAGGLVVGLSIFTFGKGGSHRYESNH"
     MVTFILQLII TFAATVAFGI LFNVPKRALL IGGAIGVCTW AVLSISMMLG AAQVVSTGLA        60
     SISAAVNAHF LARKLKLPVT TLSIPGILPL VPGSRAYFTM LAFVDGDYLQ GLEYGVETML       120
     IAGAIAGGLV VGLSIFTFGK GGSHRYESNH                                        150
//

If you have problems or comments...

PBIL Back to PBIL home page