(data stored in ACNUC7421 zone)

EMBL: CP001791.PE65

CP001791.PE65        Location/Qualifiers
FT   CDS             75947..77992
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0066"
FT                   /product="ATP-dependent metalloprotease FtsH"
FT                   /EC_number="3.6.4.3"
FT                   /note="SMART: AAA ATPase; TIGRFAM: ATP-dependent
FT                   metalloprotease FtsH; KEGG: pca:Pcar_0997 ATP-dependent
FT                   zinc protease/cell division protein; PFAM: peptidase M41;
FT                   peptidase M41 FtsH extracellular; AAA ATPase central domain
FT                   protein; ATPase associated with various cellular activities
FT                   AAA_5"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0066"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97617"
FT                   /db_xref="GOA:D6XV59"
FT                   /db_xref="InterPro:IPR000642"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR003960"
FT                   /db_xref="InterPro:IPR005936"
FT                   /db_xref="InterPro:IPR011546"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR037219"
FT                   /db_xref="InterPro:IPR041569"
FT                   /db_xref="UniProtKB/TrEMBL:D6XV59"
FT                   /inference="protein motif:TFAM:TIGR01241"
FT                   /protein_id="ADH97617.1"
FT                   /translation="MNRIFSNTLFFLLIFLVIVGIVSLFSQEPGDTSEMSFTEFKQEFQ
FT                   EGNVESLSIQPNLDVYSARGQLEGAAEDEFFTVNIPDLQVFLEDIVTASGSESLNELTI
FT                   EPADEPSGWITFFTVLIPFIIIFILFFFLISQSQGGGSKVMNFGKSKAKLVSEDKKKAR
FT                   FKDVAGADEEKQELEEVVEFLKEPRKFAEIGARIPKGVLLVGPPGTGKTLIARAVAGEA
FT                   GVPFFSISGSDFVEMFVGVGASRVRDLFENAKKNAPCIIFIDEIDAVGRRRGAGLGGGH
FT                   DEREQTLNQLLVEMDGFGVNEGIILIAATNRADILDPALLRPGRFDRQIMVGRPDVKGR
FT                   EAVLEVHAKNKPLADDVELKTIAQRTPGFSGADLENLLNEAALVAARTDKKKIDMESVE
FT                   EAIDRTIAGPSKKSRVISEKEKNIVAHHEAGHTVVGVKLVNADMVHKVTIVPRGQAGGY
FT                   AMMLPREDRYFMTKPELIDKIVGLLGGRVAEEVMFDEVSTGAHNDFQRATGIARKMVME
FT                   YGMSDKLGPVQFGNSQGEVFLGRDINSEQNYSEAIAHEIDMEVQRIIKEAYAYCKEILT
FT                   EHKDKLELVAQMLIEYETLDAEQIYSLVEEGKMPENHHMIKKLNGESEEQQVDSDEQHK
FT                   EDDASESDGETAESGDTSEVDKADQPTDTEDAGDRDEPSTDDDERK"
     MNRIFSNTLF FLLIFLVIVG IVSLFSQEPG DTSEMSFTEF KQEFQEGNVE SLSIQPNLDV        60
     YSARGQLEGA AEDEFFTVNI PDLQVFLEDI VTASGSESLN ELTIEPADEP SGWITFFTVL       120
     IPFIIIFILF FFLISQSQGG GSKVMNFGKS KAKLVSEDKK KARFKDVAGA DEEKQELEEV       180
     VEFLKEPRKF AEIGARIPKG VLLVGPPGTG KTLIARAVAG EAGVPFFSIS GSDFVEMFVG       240
     VGASRVRDLF ENAKKNAPCI IFIDEIDAVG RRRGAGLGGG HDEREQTLNQ LLVEMDGFGV       300
     NEGIILIAAT NRADILDPAL LRPGRFDRQI MVGRPDVKGR EAVLEVHAKN KPLADDVELK       360
     TIAQRTPGFS GADLENLLNE AALVAARTDK KKIDMESVEE AIDRTIAGPS KKSRVISEKE       420
     KNIVAHHEAG HTVVGVKLVN ADMVHKVTIV PRGQAGGYAM MLPREDRYFM TKPELIDKIV       480
     GLLGGRVAEE VMFDEVSTGA HNDFQRATGI ARKMVMEYGM SDKLGPVQFG NSQGEVFLGR       540
     DINSEQNYSE AIAHEIDMEV QRIIKEAYAY CKEILTEHKD KLELVAQMLI EYETLDAEQI       600
     YSLVEEGKMP ENHHMIKKLN GESEEQQVDS DEQHKEDDAS ESDGETAESG DTSEVDKADQ       660
     PTDTEDAGDR DEPSTDDDER K                                                 681
//

If you have problems or comments...

PBIL Back to PBIL home page