(data stored in ACNUC7421 zone)

EMBL: CP001791.PE66

CP001791.PE66        Location/Qualifiers
FT   CDS             78077..78844
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0067"
FT                   /product="putative transcriptional acitvator, Baf family"
FT                   /note="KEGG: glo:Glov_1318 pantothenate kinase; TIGRFAM:
FT                   transcriptional activator, Baf family; PFAM: Bvg accessory
FT                   factor"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0067"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97618"
FT                   /db_xref="GOA:D6XV60"
FT                   /db_xref="InterPro:IPR004619"
FT                   /db_xref="UniProtKB/TrEMBL:D6XV60"
FT                   /inference="protein motif:TFAM:TIGR00671"
FT                   /protein_id="ADH97618.1"
FT                   /translation="MLMKLVMDIGNTTISIGLYKKQTRIAEWTVQTDYEKTVDEYGVLL
FT                   GQLFMMNNLLTSEVKRIMVSSVVPPLDETIRQVCARYLAIEPVFVGPGVKTGLNISTEN
FT                   PREVGSDRIVNAVAALEHYTPPLIVVDFGTATTVCYVNAKRQYVGGVIAPGMSIAMDAL
FT                   YDKASKLPKIDLTATDSVIGRNTTDAMRSGYLYGYLGQMEGIVQRMKDEQGEATVVATG
FT                   DHAVILGEHSRLIDHVHPHLTLDGLAILDERQP"
     MLMKLVMDIG NTTISIGLYK KQTRIAEWTV QTDYEKTVDE YGVLLGQLFM MNNLLTSEVK        60
     RIMVSSVVPP LDETIRQVCA RYLAIEPVFV GPGVKTGLNI STENPREVGS DRIVNAVAAL       120
     EHYTPPLIVV DFGTATTVCY VNAKRQYVGG VIAPGMSIAM DALYDKASKL PKIDLTATDS       180
     VIGRNTTDAM RSGYLYGYLG QMEGIVQRMK DEQGEATVVA TGDHAVILGE HSRLIDHVHP       240
     HLTLDGLAIL DERQP                                                        255
//

If you have problems or comments...

PBIL Back to PBIL home page