(data stored in ACNUC7421 zone)

EMBL: CP001791.PE67

CP001791.PE67        Location/Qualifiers
FT   CDS             78880..79776
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0068"
FT                   /product="Hsp33 protein"
FT                   /note="PFAM: Hsp33 protein; KEGG: gme:Gmet_0041 HSP33-like
FT                   chaperonin"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0068"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97619"
FT                   /db_xref="GOA:D6XV61"
FT                   /db_xref="InterPro:IPR000397"
FT                   /db_xref="InterPro:IPR016153"
FT                   /db_xref="InterPro:IPR016154"
FT                   /db_xref="UniProtKB/TrEMBL:D6XV61"
FT                   /inference="protein motif:PFAM:PF01430"
FT                   /protein_id="ADH97619.1"
FT                   /translation="MTNDYLVKALAYEDQVRIYAINSTDMTDEAARRHQTWRTVTAALG
FT                   RALSAGTMMGSMLKGDEKLTIKIEGNGPASPMVIDANAKGKARGYVGRVDVDPERREDG
FT                   KLNVGAVVGNEGHISVVKDLGMKDYFTGSVPLVSGELGDDFTYYFASSEQTPSSVALGV
FT                   LIGEEEKVLASGGFILQLMPEASDATIDEVERILQGLPSVTEMLSEGMTPEDIVARLSG
FT                   GTHRILEKLDTAFECNCSRERIETALYSIQEDELELMITEDEGAETSCHFCNEIYTFTK
FT                   ADLETILSNRKNGIQPE"
     MTNDYLVKAL AYEDQVRIYA INSTDMTDEA ARRHQTWRTV TAALGRALSA GTMMGSMLKG        60
     DEKLTIKIEG NGPASPMVID ANAKGKARGY VGRVDVDPER REDGKLNVGA VVGNEGHISV       120
     VKDLGMKDYF TGSVPLVSGE LGDDFTYYFA SSEQTPSSVA LGVLIGEEEK VLASGGFILQ       180
     LMPEASDATI DEVERILQGL PSVTEMLSEG MTPEDIVARL SGGTHRILEK LDTAFECNCS       240
     RERIETALYS IQEDELELMI TEDEGAETSC HFCNEIYTFT KADLETILSN RKNGIQPE         298
//

If you have problems or comments...

PBIL Back to PBIL home page