(data stored in ACNUC7421 zone)

EMBL: CP001791.PE69

CP001791.PE69        Location/Qualifiers
FT   CDS             82413..83009
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0071"
FT                   /product="glutamine amidotransferase of anthranilate
FT                   synthase"
FT                   /note="KEGG: gur:Gura_1732 anthranilate synthase component
FT                   II; TIGRFAM: glutamine amidotransferase of anthranilate
FT                   synthase; PFAM: glutamine amidotransferase class-I"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0071"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97621"
FT                   /db_xref="GOA:D6XV63"
FT                   /db_xref="InterPro:IPR006221"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:D6XV63"
FT                   /inference="protein motif:TFAM:TIGR00566"
FT                   /protein_id="ADH97621.1"
FT                   /translation="MIVMIDNYDSFTYNLVQYLGEMGEELVVKRNDQVTLEEIEDLAPD
FT                   FLMISPGPCSPDEAGISMDVIRHFAGKIPVFGVCLGHQSLAQVFGGDVVQAERLMHGKT
FT                   SPVLHDGKTIFQGLESPFTATRYHSLIVKRETLPDCLEISAETAEGEIMALRHKEFAVE
FT                   GVQFHPESIMTDTGKQLLRNFLDVHRQGEAPCTSK"
     MIVMIDNYDS FTYNLVQYLG EMGEELVVKR NDQVTLEEIE DLAPDFLMIS PGPCSPDEAG        60
     ISMDVIRHFA GKIPVFGVCL GHQSLAQVFG GDVVQAERLM HGKTSPVLHD GKTIFQGLES       120
     PFTATRYHSL IVKRETLPDC LEISAETAEG EIMALRHKEF AVEGVQFHPE SIMTDTGKQL       180
     LRNFLDVHRQ GEAPCTSK                                                     198
//

If you have problems or comments...

PBIL Back to PBIL home page