(data stored in ACNUC7421 zone)

EMBL: CP001791.PE70

CP001791.PE70        Location/Qualifiers
FT   CDS             82994..83854
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0072"
FT                   /product="aminotransferase class IV"
FT                   /note="PFAM: aminotransferase class IV; KEGG: hch:HCH_06836
FT                   branched-chain amino acid aminotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0072"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97622"
FT                   /db_xref="GOA:D6XV64"
FT                   /db_xref="InterPro:IPR001544"
FT                   /db_xref="InterPro:IPR018300"
FT                   /db_xref="InterPro:IPR036038"
FT                   /db_xref="UniProtKB/TrEMBL:D6XV64"
FT                   /inference="protein motif:PFAM:PF01063"
FT                   /protein_id="ADH97622.1"
FT                   /translation="MYIKVNGTIIPEEEARISPLDHGFLYGMGLFETFRTYDGHPFLLD
FT                   EHMKRLREGADEMNIQLPAYDRQDVVETIRALLAANKNRDLYFRWNVTAGHGGVGLTAE
FT                   PYEEPGELVFVKDAPTPPATKQARVLTQTRNTPEGAVRRKSHHYMNSMLAKQELGQDPG
FT                   TEGMMLTSDGHVSEGIVSNVFWVKKDTLYTPSLETGCLPGVTRAWVADYADKQRLPFQE
FT                   GFFTAADMMQAEAVFVTNAIQEIVPVTAIDGRPFDSQTNPHLLALKQQYEIDKKQAYSL
FT                   GECGL"
     MYIKVNGTII PEEEARISPL DHGFLYGMGL FETFRTYDGH PFLLDEHMKR LREGADEMNI        60
     QLPAYDRQDV VETIRALLAA NKNRDLYFRW NVTAGHGGVG LTAEPYEEPG ELVFVKDAPT       120
     PPATKQARVL TQTRNTPEGA VRRKSHHYMN SMLAKQELGQ DPGTEGMMLT SDGHVSEGIV       180
     SNVFWVKKDT LYTPSLETGC LPGVTRAWVA DYADKQRLPF QEGFFTAADM MQAEAVFVTN       240
     AIQEIVPVTA IDGRPFDSQT NPHLLALKQQ YEIDKKQAYS LGECGL                      286
//

If you have problems or comments...

PBIL Back to PBIL home page