(data stored in ACNUC7421 zone)

EMBL: CP001791.PE72

CP001791.PE72        Location/Qualifiers
FT   CDS             84773..85147
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0074"
FT                   /product="dihydroneopterin aldolase"
FT                   /EC_number="4.1.2.25"
FT                   /note="TIGRFAM: dihydroneopterin aldolase; KEGG:
FT                   hypothetical protein; K01633 dihydroneopterin aldolase;
FT                   PFAM: dihydroneopterin aldolase"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0074"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97624"
FT                   /db_xref="GOA:D6XV66"
FT                   /db_xref="InterPro:IPR006156"
FT                   /db_xref="InterPro:IPR006157"
FT                   /db_xref="UniProtKB/TrEMBL:D6XV66"
FT                   /inference="protein motif:TFAM:TIGR00525"
FT                   /protein_id="ADH97624.1"
FT                   /translation="MDKVFVEGMKFYGYHGAYRAENELGQRFEADVLMEMDSKKAAETD
FT                   ALEDTVNYALVYETVRDIIEGEAVNLVETLANRVADDILRKFHLVEACTVKVTKPDPPI
FT                   PGHYDAVAVQVRRSRDHHAH"
     MDKVFVEGMK FYGYHGAYRA ENELGQRFEA DVLMEMDSKK AAETDALEDT VNYALVYETV        60
     RDIIEGEAVN LVETLANRVA DDILRKFHLV EACTVKVTKP DPPIPGHYDA VAVQVRRSRD       120
     HHAH                                                                    124
//

If you have problems or comments...

PBIL Back to PBIL home page