(data stored in ACNUC7421 zone)

EMBL: CP001791.PE73

CP001791.PE73        Location/Qualifiers
FT   CDS             85137..85658
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0075"
FT                   /product="2-amino-4-hydroxy-6-hydroxymethyldihydropteridine
FT                   pyrophosphokinase"
FT                   /EC_number="2.7.6.3"
FT                   /note="TIGRFAM:
FT                   2-amino-4-hydroxy-6-hydroxymethyldihydropteridine
FT                   pyrophosphokinase; KEGG: pca:Pcar_0250
FT                   2-amino-4-hydroxy-6-hydroxymethyldihydropteridine
FT                   pyrophosphokinase; PFAM:
FT                   78-dihydro-6-hydroxymethylpterin-pyrophosphokinase HPPK"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0075"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97625"
FT                   /db_xref="GOA:D6XV67"
FT                   /db_xref="InterPro:IPR000550"
FT                   /db_xref="InterPro:IPR035907"
FT                   /db_xref="UniProtKB/TrEMBL:D6XV67"
FT                   /inference="protein motif:TFAM:TIGR01498"
FT                   /protein_id="ADH97625.1"
FT                   /translation="MHTDAAKHAFIAFGSNQGERIDCLKKALKALSDHPDLSLVDVSAI
FT                   YETAPVGMTDQPSFLNMVAVFHSKLTAEALLNVTQSIEQDGGRERKERWGPRTIDLDIL
FT                   RHGTDTVDTAHLQIPHPRMMERAFVLVPLLDVAHHDPALCEDTLHEALKGCADRADVKR
FT                   ISDGLPDVDA"
     MHTDAAKHAF IAFGSNQGER IDCLKKALKA LSDHPDLSLV DVSAIYETAP VGMTDQPSFL        60
     NMVAVFHSKL TAEALLNVTQ SIEQDGGRER KERWGPRTID LDILRHGTDT VDTAHLQIPH       120
     PRMMERAFVL VPLLDVAHHD PALCEDTLHE ALKGCADRAD VKRISDGLPD VDA              173
//

If you have problems or comments...

PBIL Back to PBIL home page