(data stored in ACNUC7421 zone)

EMBL: CP001791.PE74

CP001791.PE74        Location/Qualifiers
FT   CDS             85693..86691
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0076"
FT                   /product="TIM-barrel protein, nifR3 family"
FT                   /note="KEGG: fph:Fphi_1896 tRNA-dihydrouridine synthase;
FT                   TIGRFAM: TIM-barrel protein, nifR3 family; PFAM:
FT                   dihydrouridine synthase DuS; NADH:flavin
FT                   oxidoreductase/NADH oxidase"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0076"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97626"
FT                   /db_xref="GOA:D6XV68"
FT                   /db_xref="InterPro:IPR001269"
FT                   /db_xref="InterPro:IPR004652"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR018517"
FT                   /db_xref="InterPro:IPR024036"
FT                   /db_xref="InterPro:IPR035587"
FT                   /db_xref="UniProtKB/TrEMBL:D6XV68"
FT                   /inference="protein motif:TFAM:TIGR00737"
FT                   /protein_id="ADH97626.1"
FT                   /translation="MTLSIGEITLKNPVVLAPMAGVCNPAFRLIAKEFGTGLVCAEMVS
FT                   DKAILHQNKRSINMLYVAEREKPLSLQIFGGTKETLVEAAKIVDTQTNADIIDINMGCP
FT                   VPKVTSCDAGARWLLNPDRIYEMVDAVVQAVDKPVTVKMRKGWDDDTVYAVDNAKAVEA
FT                   AGGKAIALHGRTRVQMYEGEADWSIIKTVKEAVGIPIIGNGDVQTPEDAKRMMTETGAD
FT                   GVMIGRAALGNPWMLYRTIHFLETGENIAEPSPEEKMRVAILHMDRLIDWKGERVAVKE
FT                   MRKHASYYMRGIRGAAKLRDQVNQMETREEMAGVMERIGLLDQERIPAGGS"
     MTLSIGEITL KNPVVLAPMA GVCNPAFRLI AKEFGTGLVC AEMVSDKAIL HQNKRSINML        60
     YVAEREKPLS LQIFGGTKET LVEAAKIVDT QTNADIIDIN MGCPVPKVTS CDAGARWLLN       120
     PDRIYEMVDA VVQAVDKPVT VKMRKGWDDD TVYAVDNAKA VEAAGGKAIA LHGRTRVQMY       180
     EGEADWSIIK TVKEAVGIPI IGNGDVQTPE DAKRMMTETG ADGVMIGRAA LGNPWMLYRT       240
     IHFLETGENI AEPSPEEKMR VAILHMDRLI DWKGERVAVK EMRKHASYYM RGIRGAAKLR       300
     DQVNQMETRE EMAGVMERIG LLDQERIPAG GS                                     332
//

If you have problems or comments...

PBIL Back to PBIL home page